Recombinant Human SERPINA12 protein
Cat.No. : | SERPINA12-987H |
Product Overview : | Recombinant Human SERPINA12 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 394 |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, with 0.02 % Tween-20. |
Molecular Mass : | Approximately 45.1 kDa, a single non-glycosylated polypeptide chain containing 394 amino acids. |
AA Sequence : | LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK |
Endotoxin : | Less than 0.1 EU/μg of rHuVaspin as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | SERPINA12 |
Official Symbol | SERPINA12 |
Synonyms | SERPINA12; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 12; serpin A12; OL 64; Vaspin; vaspin; visceral adipose-specific SERPIN; visceral adipose tissue-derived serine protease inhibitor; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; OL-64; |
Gene ID | 145264 |
mRNA Refseq | NM_173850 |
Protein Refseq | NP_776249 |
MIM | 617471 |
UniProt ID | Q8IW75 |
◆ Recombinant Proteins | ||
SERPINA12-5674H | Recombinant Human SERPINA12 Protein (Leu21-Lys414), N-GST tagged | +Inquiry |
SERPINA12-8038M | Recombinant Mouse SERPINA12 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA12-16H | Recombinant Human SERPINA12 Protein | +Inquiry |
Serpina12-6851R | Recombinant Rat Serpina12 Protein (Leu21-Pro411), N-His tagged | +Inquiry |
SERPINA12-3931H | Active Recombinant Human SERPINA12 Full Length protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA12-2050HCL | Recombinant Human SERPINA12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINA12 Products
Required fields are marked with *
My Review for All SERPINA12 Products
Required fields are marked with *