Recombinant Human SERPINA6
Cat.No. : | SERPINA6-26357TH |
Product Overview : | Recombinant full length mature Human Cortisol Binding Globulin with N terminal proprietary tag; Predicted MW 68.24 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 383 amino acids |
Description : | This gene encodes an alpha-globulin protein with corticosteroid-binding properties. This is the major transport protein for glucorticoids and progestins in the blood of most vertebrates. The gene localizes to a chromosomal region containing several closely related serine protease inhibitors which may have evolved by duplication events. |
Molecular Weight : | 68.240kDa inclusive of tags |
Tissue specificity : | Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKN IFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSE TEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLES FSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKI VDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFY VDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGT VFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIP KVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKS SKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQP FIIMIFDHFTWSSLFLARVMNPV |
Sequence Similarities : | Belongs to the serpin family. |
Gene Name | SERPINA6 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 [ Homo sapiens ] |
Official Symbol | SERPINA6 |
Synonyms | SERPINA6; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6; CBG, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 6; corticosteroid-binding globulin; corticosteroid bindin |
Gene ID | 866 |
mRNA Refseq | NM_001756 |
Protein Refseq | NP_001747 |
MIM | 122500 |
Uniprot ID | P08185 |
Chromosome Location | 14q31-q32.1 |
Function | serine-type endopeptidase inhibitor activity; steroid binding; |
◆ Recombinant Proteins | ||
SERPINA6-462HF | Recombinant Full Length Human SERPINA6 Protein | +Inquiry |
SERPINA6-5515H | Recombinant Human SERPINA6 protein, His-tagged | +Inquiry |
Serpina6-5834R | Recombinant Rat Serpina6 protein, His-tagged | +Inquiry |
SERPINA6-4998R | Recombinant Rat SERPINA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA6-1369H | Recombinant Human SERPINA6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBT-32010GR | Goat Anti-Rat SERPINA6 Polyclonal Antibody | +Inquiry |
SERPINA6-1948HCL | Recombinant Human SERPINA6 cell lysate | +Inquiry |
CPBT-32008RH | Rabbit Anti-Human SERPINA6 Polyclonal Antibody | +Inquiry |
SERPINA6-1910MCL | Recombinant Mouse SERPINA6 cell lysate | +Inquiry |
CPBT-32009GH | Goat Anti-Human SERPINA6 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA6 Products
Required fields are marked with *
My Review for All SERPINA6 Products
Required fields are marked with *
0
Inquiry Basket