Recombinant Human SERPINB6 protein(141-330 aa), C-His-tagged

Cat.No. : SERPINB6-2734H
Product Overview : Recombinant Human SERPINB6 protein(P35237)(141-330 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 141-330 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEA
Gene Name SERPINB6 serpin peptidase inhibitor, clade B (ovalbumin), member 6 [ Homo sapiens ]
Official Symbol SERPINB6
Synonyms SERPINB6; serpin peptidase inhibitor, clade B (ovalbumin), member 6; deafness, autosomal recessive 91 , DFNB91, PI6, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6; serpin B6; CAP; cytoplasmic antiproteinase; PTI; PI-6; protease inhibitor 6 (placental thrombin inhibitor); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6; PI6; SPI3; DFNB91; MSTP057; MGC111370; DKFZp686I04222;
Gene ID 5269
mRNA Refseq NM_001195291
Protein Refseq NP_001182220
MIM 173321
UniProt ID P35237

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINB6 Products

Required fields are marked with *

My Review for All SERPINB6 Products

Required fields are marked with *

0
cart-icon