Recombinant Human SERPINB9 protein, GST-tagged

• Cat.No.: SERPINB9-301615H
• Product Overview: Recombinant Human SERPINB9 (1-376 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Pro376
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SERPINB9 serpin peptidase inhibitor, clade B (ovalbumin), member 9 [ Homo sapiens ]
• Official Symbol: SERPINB9
• Synonyms: SERPINB9; serpin peptidase inhibitor, clade B (ovalbumin), member 9; PI9, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; serpin B9; CAP3; peptidase inhibitor 9; cytoplasmic antiproteinase 3; protease inhibitor 9 (ovalbumin type); serpin peptidase inhibitor, clade B, member 9; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; PI9; PI-9; CAP-3
• Gene ID: 5272
• mRNA Refseq: NM_004155
• Protein Refseq: NP_004146
• MIM: 601799
• UniProt ID: P50453