Recombinant Human SERPINB9 protein, GST-tagged
Cat.No. : | SERPINB9-301615H |
Product Overview : | Recombinant Human SERPINB9 (1-376 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Pro376 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SERPINB9 serpin peptidase inhibitor, clade B (ovalbumin), member 9 [ Homo sapiens ] |
Official Symbol | SERPINB9 |
Synonyms | SERPINB9; serpin peptidase inhibitor, clade B (ovalbumin), member 9; PI9, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; serpin B9; CAP3; peptidase inhibitor 9; cytoplasmic antiproteinase 3; protease inhibitor 9 (ovalbumin type); serpin peptidase inhibitor, clade B, member 9; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; PI9; PI-9; CAP-3; |
Gene ID | 5272 |
mRNA Refseq | NM_004155 |
Protein Refseq | NP_004146 |
MIM | 601799 |
UniProt ID | P50453 |
◆ Recombinant Proteins | ||
SERPINB9-5916H | Recombinant Human SERPINB9 Protein (Met1-Pro376), C-His tagged | +Inquiry |
SERPINB9-301615H | Recombinant Human SERPINB9 protein, GST-tagged | +Inquiry |
SERPINB9-3302H | Recombinant Human SERPINB9 protein, His-tagged | +Inquiry |
SERPINB9-8643H | Recombinant Human SERPINB9 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
SERPINB9-3445H | Recombinant Human SERPINB9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB9-562HCL | Recombinant Human SERPINB9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB9 Products
Required fields are marked with *
My Review for All SERPINB9 Products
Required fields are marked with *
0
Inquiry Basket