Recombinant Human SERPINB9 protein, His-tagged

Cat.No. : SERPINB9-3302H
Product Overview : Recombinant Human SERPINB9 protein(1-376 aa), fused to His tag, was expressed in E. coli.
Availability August 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-376 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SERPINB9 serpin peptidase inhibitor, clade B (ovalbumin), member 9 [ Homo sapiens ]
Official Symbol SERPINB9
Synonyms SERPINB9; serpin peptidase inhibitor, clade B (ovalbumin), member 9; PI9, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; serpin B9; CAP3; peptidase inhibitor 9; cytoplasmic antiproteinase 3; protease inhibitor 9 (ovalbumin type); serpin peptidase inhibitor, clade B, member 9; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; PI9; PI-9; CAP-3;
Gene ID 5272
mRNA Refseq NM_004155
Protein Refseq NP_004146
MIM 601799
UniProt ID P50453

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINB9 Products

Required fields are marked with *

My Review for All SERPINB9 Products

Required fields are marked with *

0
cart-icon