Recombinant Human SERPINB9 protein, His-tagged
Cat.No. : | SERPINB9-3302H |
Product Overview : | Recombinant Human SERPINB9 protein(1-376 aa), fused to His tag, was expressed in E. coli. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-376 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SERPINB9 serpin peptidase inhibitor, clade B (ovalbumin), member 9 [ Homo sapiens ] |
Official Symbol | SERPINB9 |
Synonyms | SERPINB9; serpin peptidase inhibitor, clade B (ovalbumin), member 9; PI9, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; serpin B9; CAP3; peptidase inhibitor 9; cytoplasmic antiproteinase 3; protease inhibitor 9 (ovalbumin type); serpin peptidase inhibitor, clade B, member 9; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; PI9; PI-9; CAP-3; |
Gene ID | 5272 |
mRNA Refseq | NM_004155 |
Protein Refseq | NP_004146 |
MIM | 601799 |
UniProt ID | P50453 |
◆ Recombinant Proteins | ||
SERPINB9-2146H | Recombinant Human SERPINB9 protein, His-tagged | +Inquiry |
SERPINB9-5917H | Recombinant Human SERPINB9 Protein (Met1-Pro376), N-His tagged | +Inquiry |
SERPINB9-3969R | Recombinant Rhesus Macaque SERPINB9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINB9-7027H | Recombinant Human SERPINB9 protein(Glu2-Pro376), His-tagged | +Inquiry |
SERPINB9-8643H | Recombinant Human SERPINB9 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB9-562HCL | Recombinant Human SERPINB9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB9 Products
Required fields are marked with *
My Review for All SERPINB9 Products
Required fields are marked with *