Recombinant Human SERPINB9 protein, His-tagged
| Cat.No. : | SERPINB9-3302H |
| Product Overview : | Recombinant Human SERPINB9 protein(1-376 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-376 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SERPINB9 serpin peptidase inhibitor, clade B (ovalbumin), member 9 [ Homo sapiens ] |
| Official Symbol | SERPINB9 |
| Synonyms | SERPINB9; serpin peptidase inhibitor, clade B (ovalbumin), member 9; PI9, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; serpin B9; CAP3; peptidase inhibitor 9; cytoplasmic antiproteinase 3; protease inhibitor 9 (ovalbumin type); serpin peptidase inhibitor, clade B, member 9; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; PI9; PI-9; CAP-3; |
| Gene ID | 5272 |
| mRNA Refseq | NM_004155 |
| Protein Refseq | NP_004146 |
| MIM | 601799 |
| UniProt ID | P50453 |
| ◆ Recombinant Proteins | ||
| SERPINB9-3445H | Recombinant Human SERPINB9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SERPINB9-8007H | Recombinant Human SERPINB9 protein, His & T7-tagged | +Inquiry |
| SERPINB9-2146H | Recombinant Human SERPINB9 protein, His-tagged | +Inquiry |
| SERPINB9-1006H | Recombinant Human SERPINB9 Protein, MYC/DDK-tagged | +Inquiry |
| SERPINB9-5916H | Recombinant Human SERPINB9 Protein (Met1-Pro376), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINB9-562HCL | Recombinant Human SERPINB9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB9 Products
Required fields are marked with *
My Review for All SERPINB9 Products
Required fields are marked with *



