Recombinant Human SERPINF1 protein
Cat.No. : | SERPINF1-07H |
Product Overview : | Recombinant Human SERPINF1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 399 |
Description : | Pigment epithelium-derived factor (PEDF) is encoded by the SERPINF1 gene in humans and found in verebrates. It is a secreted phosphoglycoprotein that belongs to the clade F subfamily, serpin superfamily of proteinase inhibitors. The PEDF is a noninhibitory serpin with neurotrophic, anti-angiogenic, and anti-tumorigenic properties. It is synthesized as a 418 a.a. about 50kDa precursor that contains a 19 a.a. signal sequence and a 399 a.a. mature region that shows a pyroglutamate at Gln20. Like other serpins, it contains three β-sheets, 810 α-helices, and a C-terminal RCL (reactive center loop). Unlike other serpins with Ser protease inhibiting activity. PEDF has functions of inducing extensive neuronal differentiation in retinoblastoma cells, inhibiting of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. PEDF is researched as a therapeutic candidate for treatment of such conditions as choroidal neovascularization, heart disease, and cancer. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to enhance the adhesion of human Saos2 cells to bovine Collagen I coated plate is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 44.4 KDa, a single non-glycosylated polypeptide chain containing 399 amino acids. |
AA Sequence : | QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP |
Endotoxin : | Less than 1 EU/μg of rHuPEDF as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | SERPINF1 |
Official Symbol | SERPINF1 |
Synonyms | SERPINF1; serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; PEDF, serine (or cysteine) proteinase inhibitor, clade F (alpha 2 antiplasmin, pigment epithelium derived factor), member 1; pigment epithelium-derived factor; EPC 1; PIG35; pigment epithelium derived factor; proliferation inducing protein 35; serpin F1; cell proliferation-inducing gene 35 protein; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; OI6; OI12; PEDF; EPC-1; |
Gene ID | 5176 |
mRNA Refseq | NM_002615 |
Protein Refseq | NP_002606 |
MIM | 172860 |
UniProt ID | P36955 |
◆ Recombinant Proteins | ||
SERPINF1-913C | Recombinant Cynomolgus SERPINF1 Protein, His-tagged | +Inquiry |
SERPINF1-29166TH | Recombinant Human SERPINF1 | +Inquiry |
SERPINF1-1982H | Recombinant Human SERPINF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Serpinf1-3486R | Recombinant Rat Serpinf1 protein, GST-tagged | +Inquiry |
SERPINF1-2567H | Recombinant Human SERPINF1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINF1-2500HCL | Recombinant Human SERPINF1 cell lysate | +Inquiry |
SERPINF1-2673MCL | Recombinant Mouse SERPINF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINF1 Products
Required fields are marked with *
My Review for All SERPINF1 Products
Required fields are marked with *
0
Inquiry Basket