Recombinant Human SERTM1 Protein, GST-tagged
| Cat.No. : | SERTM1-530H |
| Product Overview : | Human C13orf36 full-length ORF (AAH36540.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 38.17 kDa |
| AA Sequence : | MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNIISSSSSYPGYPSDAGSSFTNLEVCSISSQRSTFSNLSS |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SERTM1 serine-rich and transmembrane domain containing 1 [ Homo sapiens ] |
| Official Symbol | SERTM1 |
| Synonyms | SERTM1; serine-rich and transmembrane domain containing 1; C13orf36, chromosome 13 open reading frame 36; serine-rich and transmembrane domain-containing protein 1; serine-rich and transmembrane domain-containing 1; C13orf36; RP11-16L6.1; MGC33996; |
| Gene ID | 400120 |
| mRNA Refseq | NM_203451 |
| Protein Refseq | NP_982276 |
| UniProt ID | A2A2V5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERTM1 Products
Required fields are marked with *
My Review for All SERTM1 Products
Required fields are marked with *
