Recombinant Human SERTM1 Protein, GST-tagged
Cat.No. : | SERTM1-530H |
Product Overview : | Human C13orf36 full-length ORF (AAH36540.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.17 kDa |
AA Sequence : | MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNIISSSSSYPGYPSDAGSSFTNLEVCSISSQRSTFSNLSS |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SERTM1 serine-rich and transmembrane domain containing 1 [ Homo sapiens ] |
Official Symbol | SERTM1 |
Synonyms | SERTM1; serine-rich and transmembrane domain containing 1; C13orf36, chromosome 13 open reading frame 36; serine-rich and transmembrane domain-containing protein 1; serine-rich and transmembrane domain-containing 1; C13orf36; RP11-16L6.1; MGC33996; |
Gene ID | 400120 |
mRNA Refseq | NM_203451 |
Protein Refseq | NP_982276 |
UniProt ID | A2A2V5 |
◆ Cell & Tissue Lysates | ||
SERTM1-8297HCL | Recombinant Human C13orf36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERTM1 Products
Required fields are marked with *
My Review for All SERTM1 Products
Required fields are marked with *