Recombinant Human SET

Cat.No. : SET-30076TH
Product Overview : Recombinant full length Human SET isoform 2 with N terminal proprietary tag, 55.88kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 277 amino acids
Description : The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 55.880kDa inclusive of tags
Tissue specificity : Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms tumor.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQN EIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPN FWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKS GYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKW KSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDE EEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD
Sequence Similarities : Belongs to the nucleosome assembly protein (NAP) family.
Gene Name SET SET nuclear oncogene [ Homo sapiens ]
Official Symbol SET
Synonyms SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor;
Gene ID 6418
mRNA Refseq NM_001122821
Protein Refseq NP_001116293
MIM 600960
Uniprot ID Q01105
Chromosome Location 9q34
Pathway Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; Stabilization of mRNA by HuR, organism-specific biosystem;
Function histone binding; protein binding; protein phosphatase inhibitor activity; protein phosphatase type 2A regulator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SET Products

Required fields are marked with *

My Review for All SET Products

Required fields are marked with *

0
cart-icon
0
compare icon