Recombinant Human SET
Cat.No. : | SET-30076TH |
Product Overview : | Recombinant full length Human SET isoform 2 with N terminal proprietary tag, 55.88kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 277 amino acids |
Description : | The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 55.880kDa inclusive of tags |
Tissue specificity : | Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms tumor. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQN EIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPN FWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKS GYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKW KSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDE EEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD |
Sequence Similarities : | Belongs to the nucleosome assembly protein (NAP) family. |
Gene Name | SET SET nuclear oncogene [ Homo sapiens ] |
Official Symbol | SET |
Synonyms | SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor; |
Gene ID | 6418 |
mRNA Refseq | NM_001122821 |
Protein Refseq | NP_001116293 |
MIM | 600960 |
Uniprot ID | Q01105 |
Chromosome Location | 9q34 |
Pathway | Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; Stabilization of mRNA by HuR, organism-specific biosystem; |
Function | histone binding; protein binding; protein phosphatase inhibitor activity; protein phosphatase type 2A regulator activity; |
◆ Recombinant Proteins | ||
Set-13MFL | Recombinant Full Length Mouse SET nuclear oncogene Protein, Flag tagged | +Inquiry |
SET-14976M | Recombinant Mouse SET Protein | +Inquiry |
SET-237H | Recombinant Human SET nuclear oncogene, His-tagged | +Inquiry |
SET-8065M | Recombinant Mouse SET Protein, His (Fc)-Avi-tagged | +Inquiry |
SET-30076TH | Recombinant Human SET | +Inquiry |
◆ Cell & Tissue Lysates | ||
SET-1928HCL | Recombinant Human SET 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SET Products
Required fields are marked with *
My Review for All SET Products
Required fields are marked with *