Recombinant Human SETD7, GST-tagged

Cat.No. : SETD7-29235TH
Product Overview : Recombinant fragment: FFFDGSTLEG YYVDDALQGQ GVYTYEDGGV LQGTYVDGEL NGPAQEYDTD GRLIFKGQYK DNIRHGVCWI YYPDGGSLVG EVNEDGEMTG EKIAYV, corresponding to amino acids 52-147 of Human KMT7 / SETD7/ SET7/9, with N-terminal proprietary tag, 61 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 52-147 a.a.
Description : Histone-lysine N-methyltransferase SETD7 is an enzyme that in humans is encoded by the SETD7 gene.
Conjugation : GST
Tissue specificity : Widely expressed. Expressed in pancreatic islets.
Biological activity : Specific Activity: 140 pmol/min/mg.Assay conditions: 50 μl reaction mix (50 mMTRIS pH8.8, 5 mM MgCl2, 4 mM DTT, 20 μMS-adenosylhomocysteine, and 0-10 ng SET7/9)add to the wells coated with the substrate.Incubate for 1 hr. Add antibody againstmethylated K4
Form : Liquid
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.05% Tween 20, 3mM DTT, 25mM Tris HCl, 100mM Sodium chloride, pH 8
Storage : Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : FFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYV
Sequence Similarities : Belongs to the histone-lysine methyltransferase family. SET7 subfamily.Contains 3 MORN repeats.Contains 1 SET domain.
Gene Name SETD7 SET domain containing (lysine methyltransferase) 7 [ Homo sapiens ]
Official Symbol SETD7
Synonyms SETD7; SET domain containing (lysine methyltransferase) 7; histone-lysine N-methyltransferase SETD7; KIAA1717; KMT7; SET7; SET7/9; Set9;
Gene ID 80854
mRNA Refseq NM_030648
Protein Refseq NP_085151
MIM 606594
Uniprot ID Q8WTS6
Chromosome Location 4q31.1
Pathway Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem; p53 pathway, organism-specific biosystem;
Function histone-lysine N-methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; p53 binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SETD7 Products

Required fields are marked with *

My Review for All SETD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon