Recombinant Human SETD9 Protein, GST-tagged
Cat.No. : | SETD9-5217H |
Product Overview : | Human C5orf35 full-length ORF ( NP_714917.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SETD9 (SET Domain Containing 9) is a Protein Coding gene. Among its related pathways are Regulation of TP53 Activity and Gene Expression. GO annotations related to this gene include methyltransferase activity. |
Molecular Mass : | 60.6 kDa |
AA Sequence : | MPGRLLRGLWQRWRRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLGTLLKVFQALFLNDFNKQSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTLGFSVAQATSSLISAGKGVFVTKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLDGVLIDGNDKGISKVVYRSCNGRDRLGPLKMSDSTWLTSEIHNPLAVGQYVNNCSNDRAANVCYQEFDVPAVFPIELKQYLPNIAYSYDKQSPLRCVVLVALRDINQGEELFSNYYTIVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SETD9 SET domain containing 9 [ Homo sapiens (human) ] |
Official Symbol | SETD9 |
Synonyms | C5orf35; SETD9; SET domain containing 9; SET domain-containing protein 9 |
Gene ID | 133383 |
mRNA Refseq | NM_001171990 |
Protein Refseq | NP_001165461 |
UniProt ID | Q8NE22 |
◆ Recombinant Proteins | ||
SETD9-5217H | Recombinant Human SETD9 Protein, GST-tagged | +Inquiry |
SETD9-4432H | Recombinant Human SETD9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SETD9-3847HF | Recombinant Full Length Human SETD9 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETD9-8012HCL | Recombinant Human C5orf35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SETD9 Products
Required fields are marked with *
My Review for All SETD9 Products
Required fields are marked with *
0
Inquiry Basket