Recombinant Human SF3B14 protein, GST-tagged

• Cat.No.: SF3B14-1791H
• Product Overview: Recombinant Human SF3B14 protein(1-125 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-125 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SF3B14 splicing factor 3B, 14 kDa subunit [ Homo sapiens ]
• Official Symbol: SF3B14
• Synonyms: SF3B14; splicing factor 3B, 14 kDa subunit; pre-mRNA branch site protein p14; SF3b 14 kDa subunit; spliceosome-associated protein, 14 kDa subunit; P14; Ht006; SAP14; CGI-110; HSPC175; SF3B14a
• Gene ID: 51639
• mRNA Refseq: NM_016047
• Protein Refseq: NP_057131
• MIM: 607835
• UniProt ID: Q9Y3B4