Recombinant Human SF3B4 protein, His-tagged
Cat.No. : | SF3B4-3824H |
Product Overview : | Recombinant Human SF3B4 protein(1-200 aa), fused to His tag, was expressed in E. coli. |
Availability | September 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-200 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SF3B4 splicing factor 3b, subunit 4, 49kDa [ Homo sapiens ] |
Official Symbol | SF3B4 |
Synonyms | SF3B4; splicing factor 3b, subunit 4, 49kDa; splicing factor 3b, subunit 4, 49kD; splicing factor 3B subunit 4; Hsh49; SAP49; SF3b49; SAP 49; SF3b50; spliceosomal protein; spliceosome-associated protein 49; spliceosome-associated protein (U2 snRNP); pre-mRNA splicing factor SF3b 49 kDa subunit; pre-mRNA-splicing factor SF3b 49 kDa subunit; MGC10828; |
Gene ID | 10262 |
mRNA Refseq | NM_005850 |
Protein Refseq | NP_005841 |
MIM | 605593 |
UniProt ID | Q15427 |
◆ Recombinant Proteins | ||
SF3B4-5352R | Recombinant Rat SF3B4 Protein | +Inquiry |
SF3B4-5011R | Recombinant Rat SF3B4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SF3B4-2614H | Recombinant Human SF3B4, GST-tagged | +Inquiry |
SF3B4-3987R | Recombinant Rhesus Macaque SF3B4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SF3B4-15000M | Recombinant Mouse SF3B4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SF3B4-586HCL | Recombinant Human SF3B4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SF3B4 Products
Required fields are marked with *
My Review for All SF3B4 Products
Required fields are marked with *