Recombinant Human SF3B4 protein, His-tagged

• Cat.No.: SF3B4-3824H
• Product Overview: Recombinant Human SF3B4 protein(1-200 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-200 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SF3B4 splicing factor 3b, subunit 4, 49kDa [ Homo sapiens ]
• Official Symbol: SF3B4
• Synonyms: SF3B4; splicing factor 3b, subunit 4, 49kDa; splicing factor 3b, subunit 4, 49kD; splicing factor 3B subunit 4; Hsh49; SAP49; SF3b49; SAP 49; SF3b50; spliceosomal protein; spliceosome-associated protein 49; spliceosome-associated protein (U2 snRNP); pre-mRNA splicing factor SF3b 49 kDa subunit; pre-mRNA-splicing factor SF3b 49 kDa subunit; MGC10828
• Gene ID: 10262
• mRNA Refseq: NM_005850
• Protein Refseq: NP_005841
• MIM: 605593
• UniProt ID: Q15427