Recombinant Human SFRP2 protein(68-186aa), His-GST-tagged

Cat.No. : SFRP2-422H
Product Overview : Recombinant Human SFRP2 protein(Q96HF1)(68-186aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 68-186aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.9 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM
Gene Name SFRP2 secreted frizzled-related protein 2 [ Homo sapiens ]
Official Symbol SFRP2
Synonyms SFRP2; secreted frizzled-related protein 2; FRP 2; SARP1; SDF 5; SARP-1; sFRP-2; secreted apoptosis related protein 1; secreted apoptosis-related protein 1; FRP-2; SDF-5;
Gene ID 6423
mRNA Refseq NM_003013
Protein Refseq NP_003004
MIM 604157
UniProt ID Q96HF1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFRP2 Products

Required fields are marked with *

My Review for All SFRP2 Products

Required fields are marked with *

0
cart-icon