Recombinant Human SFTPA1 protein, His-B2M & Myc-tagged
Cat.No. : | SFTPA1-2445H |
Product Overview : | Recombinant Human SFTPA1 protein(Q8IWL2)(21-248aa), fused to N-terminal His-B2M tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His&Myc |
Protein Length : | 21-248aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.2 kDa |
AA Sequence : | EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SFTPA1 surfactant protein A1 [ Homo sapiens ] |
Official Symbol | SFTPA1 |
Synonyms | SFTPA1; surfactant protein A1; SFTP1, surfactant, pulmonary associated protein A1; pulmonary surfactant-associated protein A1; COLEC4; SP A; SP A1; surfactant; pulmonary associated protein A1A; collectin-4; surfactant protein A1B; alveolar proteinosis protein; surfactant protein A1 variant AD 6A; surfactant protein A1 variant AD 6A2; surfactant protein A1 variant AD 6A3; surfactant protein A1 variant AD 6A4; surfactant protein A1 variant ACD 6A2; surfactant protein A1 variant ACD 6A3; surfactant protein A1 variant ACD 6A4; surfactant protein A1 variant ABD 6A2; surfactant protein A1 variant ABD 6A3; surfactant protein A1 variant ABD 6A4; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; 35 kDa pulmonary surfactant-associated protein; SPA; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; SFTPA1B; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; |
Gene ID | 653509 |
mRNA Refseq | NM_001093770 |
Protein Refseq | NP_001087239 |
MIM | 178630 |
UniProt ID | Q8IWL2 |
◆ Recombinant Proteins | ||
SFTPA1-11H | Recombinant Human SFTPA1 protein, MYC/DDK-tagged | +Inquiry |
SFTPA1-7889H | Recombinant Human SFTPA1 protein, His & GST-tagged | +Inquiry |
SFTPA1-2475H | Recombinant Human SFTPA1 protein, His-tagged | +Inquiry |
SFTPA1-4980HFL | Recombinant Full Length Human SFTPA1 protein, Flag-tagged | +Inquiry |
SFTPA1-4176R | Recombinant Rhesus monkey SFTPA1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPA1 Products
Required fields are marked with *
My Review for All SFTPA1 Products
Required fields are marked with *
0
Inquiry Basket