Recombinant Human SFTPA1 protein, His-B2M & Myc-tagged

Cat.No. : SFTPA1-2445H
Product Overview : Recombinant Human SFTPA1 protein(Q8IWL2)(21-248aa), fused to N-terminal His-B2M tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His&Myc
Protein Length : 21-248aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 41.2 kDa
AA Sequence : EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name SFTPA1 surfactant protein A1 [ Homo sapiens ]
Official Symbol SFTPA1
Synonyms SFTPA1; surfactant protein A1; SFTP1, surfactant, pulmonary associated protein A1; pulmonary surfactant-associated protein A1; COLEC4; SP A; SP A1; surfactant; pulmonary associated protein A1A; collectin-4; surfactant protein A1B; alveolar proteinosis protein; surfactant protein A1 variant AD 6A; surfactant protein A1 variant AD 6A2; surfactant protein A1 variant AD 6A3; surfactant protein A1 variant AD 6A4; surfactant protein A1 variant ACD 6A2; surfactant protein A1 variant ACD 6A3; surfactant protein A1 variant ACD 6A4; surfactant protein A1 variant ABD 6A2; surfactant protein A1 variant ABD 6A3; surfactant protein A1 variant ABD 6A4; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; 35 kDa pulmonary surfactant-associated protein; SPA; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; SFTPA1B; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590;
Gene ID 653509
mRNA Refseq NM_001093770
Protein Refseq NP_001087239
MIM 178630
UniProt ID Q8IWL2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFTPA1 Products

Required fields are marked with *

My Review for All SFTPA1 Products

Required fields are marked with *

0
cart-icon