Recombinant Human SFTPB Protein (201-279 aa)
| Cat.No. : | SFTPB-2223H |
| Product Overview : | Recombinant Human SFTPB Protein (201-279 aa) is produced by Yeast expression system. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | Non |
| Protein Length : | 201-279 aa |
| Description : | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 8.7 kDa |
| AA Sequence : | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | SFTPB surfactant protein B [ Homo sapiens ] |
| Official Symbol | SFTPB |
| Synonyms | SFTPB; surfactant protein B; SP B; 6 kDa protein; SP-B; PSP-B; SFTB3; SFTP3; SMDP1; |
| Gene ID | 6439 |
| mRNA Refseq | NM_000542 |
| Protein Refseq | NP_000533 |
| MIM | 178640 |
| UniProt ID | P07988 |
| ◆ Recombinant Proteins | ||
| SFTPB-6267H | Recombinant Human SFTPB Protein (Phe201-Leu381), N-His tagged | +Inquiry |
| SFTPB-2395H | Recombinant Human SFTPB protein, His-SUMO-tagged | +Inquiry |
| SFTPB-1980H | Recombinant Human SFTPB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SFTPB-1993H | Recombinant Human SFTPB Protein, His (Fc)-Avi-tagged | +Inquiry |
| Sftpb-1720M | Recombinant Mouse Sftpb protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
| SFTPB-1898HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPB Products
Required fields are marked with *
My Review for All SFTPB Products
Required fields are marked with *
