Recombinant Human SFTPB protein, His-SUMO-tagged
| Cat.No. : | SFTPB-2395H |
| Product Overview : | Recombinant Human SFTPB protein(P07988)(201-279aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 201-279aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.7 kDa |
| AA Sequence : | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SFTPB surfactant protein B [ Homo sapiens ] |
| Official Symbol | SFTPB |
| Synonyms | SFTPB; surfactant protein B; SFTP3, surfactant, pulmonary associated protein B; pulmonary surfactant-associated protein B; SP B; 6 kDa protein; 18 kDa pulmonary-surfactant protein; pulmonary surfactant-associated proteolipid SPL(Phe); SP-B; PSP-B; SFTB3; SFTP3; SMDP1; |
| Gene ID | 6439 |
| mRNA Refseq | NM_000542 |
| Protein Refseq | NP_000533 |
| MIM | 178640 |
| UniProt ID | P07988 |
| ◆ Recombinant Proteins | ||
| SFTPB-2810H | Recombinant Human SFTPB Protein (201-279 aa), MBP-tagged | +Inquiry |
| SFTPB-5358R | Recombinant Rat SFTPB Protein | +Inquiry |
| Sftpb-1720M | Recombinant Mouse Sftpb protein, His-tagged | +Inquiry |
| SFTPB-8090M | Recombinant Mouse SFTPB Protein, His (Fc)-Avi-tagged | +Inquiry |
| SFTPB-30333TH | Recombinant Human SFTPB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SFTPB-1898HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
| SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPB Products
Required fields are marked with *
My Review for All SFTPB Products
Required fields are marked with *
