Recombinant Human SFTPB protein, His-SUMO-tagged
Cat.No. : | SFTPB-2395H |
Product Overview : | Recombinant Human SFTPB protein(P07988)(201-279aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 201-279aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.7 kDa |
AA Sequence : | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SFTPB surfactant protein B [ Homo sapiens ] |
Official Symbol | SFTPB |
Synonyms | SFTPB; surfactant protein B; SFTP3, surfactant, pulmonary associated protein B; pulmonary surfactant-associated protein B; SP B; 6 kDa protein; 18 kDa pulmonary-surfactant protein; pulmonary surfactant-associated proteolipid SPL(Phe); SP-B; PSP-B; SFTB3; SFTP3; SMDP1; |
Gene ID | 6439 |
mRNA Refseq | NM_000542 |
Protein Refseq | NP_000533 |
MIM | 178640 |
UniProt ID | P07988 |
◆ Recombinant Proteins | ||
SFTPB-2395H | Recombinant Human SFTPB protein, His-SUMO-tagged | +Inquiry |
Sftpb-1720M | Recombinant Mouse Sftpb protein, His-tagged | +Inquiry |
SFTPB-6267H | Recombinant Human SFTPB Protein (Phe201-Leu381), N-His tagged | +Inquiry |
SFTPB-2286B | Recombinant Bovine SFTPB Protein (23-187 aa), His-Myc-tagged | +Inquiry |
SFTPB-5017R | Recombinant Rat SFTPB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPB-1898HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFTPB Products
Required fields are marked with *
My Review for All SFTPB Products
Required fields are marked with *
0
Inquiry Basket