Recombinant Human SFTPC Protein (24-58 aa), His-tagged

• Cat.No.: SFTPC-1517H
• Product Overview: Recombinant Human SFTPC Protein (24-58 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein.

Specification

• Description: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 5.7 kDa
• Protein length: 24-58 aa
• AA Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: SFTPC surfactant protein C [ Homo sapiens ]
• Official Symbol: SFTPC
• Synonyms: SFTPC; PSP C; SMDP2; SP C; SP5; SP-C; PSP-C; SFTP2
• Gene ID: 6440
• mRNA Refseq: NM_001172357
• Protein Refseq: NP_001165828
• MIM: 178620
• UniProt ID: P11686

Reviews

07/22/2022

Efficient protein purification; excellent yield and purity.

03/12/2020

Invaluable expertise in protein engineering; exceptional service.

05/24/2019

Trustworthy peptide synthesis; aids in our peptide-based research.

Q&As

How do environmental factors, such as pollutants or pathogens, influence SFTPC expression and function?

Environmental factors affect SFTPC expression, impacting lung defense mechanisms and susceptibility to lung diseases.

What are the molecular mechanisms underlying SFTPC-related interstitial lung disease in adults and children?

Molecular mechanisms of SFTPC-related interstitial lung disease involve disrupted surfactant metabolism and increased lung tissue inflammation.

What role does SFTPC play in the lung's response to injury and infection, including inflammation and repair processes?

SFTPC is crucial in the lung's response to injury and infection, modulating inflammatory responses and tissue repair.

What therapeutic strategies can be developed targeting SFTPC to treat lung diseases like pulmonary fibrosis and acute respiratory distress syndrome (ARDS)?

Therapeutic strategies targeting SFTPC can be effective in treating lung conditions like pulmonary fibrosis and ARDS by restoring surfactant function and reducing inflammation.

How does SFTPC deficiency affect the surfactant composition and function in the alveolar space?

SFTPC deficiency alters surfactant composition and function, compromising lung elasticity and gas exchange in the alveolar space.

What is the impact of SFTPC mutations on lung function and development, particularly in neonatal respiratory disorders?

Mutations in SFTPC impair lung function and development, leading to neonatal respiratory disorders by disrupting surfactant homeostasis.

How does SFTPC interact with other surfactant proteins and lipids to maintain lung homeostasis?

SFTPC collaborates with other surfactant proteins and lipids to maintain lung stability and prevent alveolar collapse.