Recombinant Human SGCG

Cat.No. : SGCG-26403TH
Product Overview : Recombinant fragment corresponding to amino acids 191-290 of Human gamma Sarcoglycan with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in skeletal and heart muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHIC
Sequence Similarities : Belongs to the sarcoglycan beta/delta/gamma/zeta family.
Gene Name SGCG sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) [ Homo sapiens ]
Official Symbol SGCG
Synonyms SGCG; sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein); DMDA1, LGMD2C, MAM, sarcoglycan, gamma (35kD dystrophin associated glycoprotein); gamma-sarcoglycan; 35kD dystrophin associated glycoprotein; A4; DAGA4; DMDA; gamma sarcoglycan; limb gi
Gene ID 6445
mRNA Refseq NM_000231
Protein Refseq NP_000222
MIM 608896
Uniprot ID Q13326
Chromosome Location 13q12-q13
Pathway Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SGCG Products

Required fields are marked with *

My Review for All SGCG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon