Recombinant Human SGMS1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | SGMS1-1318H |
| Product Overview : | Recombinant Human SGMS1 protein(Q86VZ5)(1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-419aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.4 kDa |
| AA Sequence : | MLSASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSS DNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKE MIKIPMPELERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFF DHFNRVQWAFSICEINGMILVGLWLIQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTT LPVPGMHFNCSPKLFGDWEAQLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYL FIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQ VLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| SGMS1-6872HF | Recombinant Full Length Human SGMS1 Protein, GST-tagged | +Inquiry |
| SGMS1-3998R | Recombinant Rhesus Macaque SGMS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SGMS1-1292H | Recombinant Human SGMS1 Protein, Strep II-tagged | +Inquiry |
| RFL7962RF | Recombinant Full Length Rat Phosphatidylcholine:Ceramide Cholinephosphotransferase 1(Sgms1) Protein, His-Tagged | +Inquiry |
| SGMS1-5960C | Recombinant Chicken SGMS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SGMS1-592HCL | Recombinant Human SGMS1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGMS1 Products
Required fields are marked with *
My Review for All SGMS1 Products
Required fields are marked with *



