Recombinant Human SGSH protein, His-tagged
Cat.No. : | SGSH-195H |
Product Overview : | Recombinant Human SGSH fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes one of several enzymes involved in the lysosomal degradation of heparan sulfate. Mutations in this gene are associated with Sanfilippo syndrome A, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. Transcripts of varying sizes have been reported but their biological validity has not been determined. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,10%Glycerol,pH7.5 |
Molecular Mass : | 55.72kD |
AA Sequence : | RPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSCSPSRASLLTGLPQHQNGMYGLHQDV HHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRP FFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGR MDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTP TILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMP FPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAK WQWETHDPWVCAPDGVLEEKLSPQCQPLHNELVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | SGSH N-sulfoglucosamine sulfohydrolase [ Homo sapiens ] |
Official Symbol | SGSH |
Synonyms | SGSH; N-sulfoglucosamine sulfohydrolase; N-sulphoglucosamine sulphohydrolase; HSS; MPS3A; mucopolysaccharidosis type IIIA; SFMD; sulfamidase; sulphamidase; heparan sulfate sulfatase; sulfoglucosamine sulfamidase; |
Gene ID | 6448 |
mRNA Refseq | NM_000199 |
Protein Refseq | NP_000190 |
MIM | 605270 |
UniProt ID | P51688 |
Chromosome Location | 17q25.3 |
Pathway | Glycosaminoglycan degradation, organism-specific biosystem; Glycosaminoglycan degradation, conserved biosystem; Heparan sulfate degradation, organism-specific biosystem; Heparan sulfate degradation, conserved biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | N-sulfoglucosamine sulfohydrolase activity; catalytic activity; hydrolase activity; metal ion binding; sulfuric ester hydrolase activity; |
◆ Recombinant Proteins | ||
SGSH-6276H | Recombinant Human SGSH Protein (Arg21-Asn389), N-GST tagged | +Inquiry |
SGSH-6275H | Recombinant Human SGSH Protein (Arg21-Leu502), C-His tagged | +Inquiry |
SGSH-473HF | Recombinant Full Length Human SGSH Protein | +Inquiry |
SGSH-280H | Recombinant Human SGSH, GST-tagged | +Inquiry |
SGSH-195H | Recombinant Human SGSH protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGSH-1884HCL | Recombinant Human SGSH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGSH Products
Required fields are marked with *
My Review for All SGSH Products
Required fields are marked with *