Recombinant Human SH3BGRL

Cat.No. : SH3BGRL-30811TH
Product Overview : Recombinant full length Human SH3BGRL with N-terminal proprietary tag. Predicted MW 38.65kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 114 amino acids
Description : SH3 domain-binding glutamic acid-rich-like protein is a protein that in humans is encoded by the SH3BGRL gene.
Molecular Weight : 38.650kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIA ANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYD AFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Sequence Similarities : Belongs to the SH3BGR family.
Gene Name SH3BGRL SH3 domain binding glutamic acid-rich protein like [ Homo sapiens ]
Official Symbol SH3BGRL
Synonyms SH3BGRL; SH3 domain binding glutamic acid-rich protein like; SH3 domain-binding glutamic acid-rich-like protein; MGC117402;
Gene ID 6451
mRNA Refseq NM_003022
Protein Refseq NP_003013
MIM 300190
Uniprot ID O75368
Chromosome Location Xq13.3
Pathway EGFR1 Signaling Pathway, organism-specific biosystem;
Function SH3 domain binding; SH3/SH2 adaptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH3BGRL Products

Required fields are marked with *

My Review for All SH3BGRL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon