Recombinant Human SH3BGRL
| Cat.No. : | SH3BGRL-30811TH |
| Product Overview : | Recombinant full length Human SH3BGRL with N-terminal proprietary tag. Predicted MW 38.65kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 114 amino acids |
| Description : | SH3 domain-binding glutamic acid-rich-like protein is a protein that in humans is encoded by the SH3BGRL gene. |
| Molecular Weight : | 38.650kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIA ANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYD AFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
| Sequence Similarities : | Belongs to the SH3BGR family. |
| Gene Name | SH3BGRL SH3 domain binding glutamic acid-rich protein like [ Homo sapiens ] |
| Official Symbol | SH3BGRL |
| Synonyms | SH3BGRL; SH3 domain binding glutamic acid-rich protein like; SH3 domain-binding glutamic acid-rich-like protein; MGC117402; |
| Gene ID | 6451 |
| mRNA Refseq | NM_003022 |
| Protein Refseq | NP_003013 |
| MIM | 300190 |
| Uniprot ID | O75368 |
| Chromosome Location | Xq13.3 |
| Pathway | EGFR1 Signaling Pathway, organism-specific biosystem; |
| Function | SH3 domain binding; SH3/SH2 adaptor activity; |
| ◆ Recombinant Proteins | ||
| SH3BGRL-4553H | Recombinant Human SH3BGRL protein, His-GST-tagged | +Inquiry |
| SH3BGRL-4003R | Recombinant Rhesus Macaque SH3BGRL Protein, His (Fc)-Avi-tagged | +Inquiry |
| SH3BGRL-2644H | Recombinant Human SH3BGRL protein, GST-tagged | +Inquiry |
| SH3BGRL-15063M | Recombinant Mouse SH3BGRL Protein | +Inquiry |
| SH3BGRL-1946C | Recombinant Chicken SH3BGRL | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SH3BGRL-1874HCL | Recombinant Human SH3BGRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3BGRL Products
Required fields are marked with *
My Review for All SH3BGRL Products
Required fields are marked with *
