Recombinant Human SH3BGRL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SH3BGRL2-5009H
• Product Overview: SH3BGRL2 MS Standard C13 and N15-labeled recombinant protein (NP_113657) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SH3BGRL2 (SH3 Domain Binding Glutamate Rich Protein Like 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include SH3 domain binding and protein disulfide oxidoreductase activity. An important paralog of this gene is SH3BGR.
• Molecular Mass: 12.1 kDa
• AA Sequence: MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SH3BGRL2 SH3 domain binding glutamic acid-rich protein like 2 [ Homo sapiens (human) ]
• Official Symbol: SH3BGRL2
• Synonyms: SH3BGRL2; SH3 domain binding glutamic acid-rich protein like 2; SH3 domain-binding glutamic acid-rich-like protein 2; fovea-associated SH3 domain-binding protein; FASH3
• Gene ID: 83699
• mRNA Refseq: NM_031469
• Protein Refseq: NP_113657
• MIM: 615678
• UniProt ID: Q9UJC5