Recombinant Human SH3BGRL2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SH3BGRL2-5009H |
Product Overview : | SH3BGRL2 MS Standard C13 and N15-labeled recombinant protein (NP_113657) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SH3BGRL2 (SH3 Domain Binding Glutamate Rich Protein Like 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include SH3 domain binding and protein disulfide oxidoreductase activity. An important paralog of this gene is SH3BGR. |
Molecular Mass : | 12.1 kDa |
AA Sequence : | MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SH3BGRL2 SH3 domain binding glutamic acid-rich protein like 2 [ Homo sapiens (human) ] |
Official Symbol | SH3BGRL2 |
Synonyms | SH3BGRL2; SH3 domain binding glutamic acid-rich protein like 2; SH3 domain-binding glutamic acid-rich-like protein 2; fovea-associated SH3 domain-binding protein; FASH3 |
Gene ID | 83699 |
mRNA Refseq | NM_031469 |
Protein Refseq | NP_113657 |
MIM | 615678 |
UniProt ID | Q9UJC5 |
◆ Recombinant Proteins | ||
SH3BGRL2-414Z | Recombinant Zebrafish SH3BGRL2 | +Inquiry |
SH3BGRL2-30170H | Recombinant Human SH3BGRL2 protein, GST-tagged | +Inquiry |
SH3BGRL2-7146H | Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 2, His-tagged | +Inquiry |
SH3BGRL2-1334H | Recombinant Human SH3BGRL2 Protein, MYC/DDK-tagged | +Inquiry |
SH3BGRL2-2645H | Recombinant Human SH3BGRL2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3BGRL2-594HCL | Recombinant Human SH3BGRL2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3BGRL2 Products
Required fields are marked with *
My Review for All SH3BGRL2 Products
Required fields are marked with *