Recombinant Human SH3BGRL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SH3BGRL2-5009H
Product Overview : SH3BGRL2 MS Standard C13 and N15-labeled recombinant protein (NP_113657) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SH3BGRL2 (SH3 Domain Binding Glutamate Rich Protein Like 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include SH3 domain binding and protein disulfide oxidoreductase activity. An important paralog of this gene is SH3BGR.
Molecular Mass : 12.1 kDa
AA Sequence : MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SH3BGRL2 SH3 domain binding glutamic acid-rich protein like 2 [ Homo sapiens (human) ]
Official Symbol SH3BGRL2
Synonyms SH3BGRL2; SH3 domain binding glutamic acid-rich protein like 2; SH3 domain-binding glutamic acid-rich-like protein 2; fovea-associated SH3 domain-binding protein; FASH3
Gene ID 83699
mRNA Refseq NM_031469
Protein Refseq NP_113657
MIM 615678
UniProt ID Q9UJC5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH3BGRL2 Products

Required fields are marked with *

My Review for All SH3BGRL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon