Recombinant Human SH3BGRL3 protein, GST-tagged
Cat.No. : | SH3BGRL3-1227H |
Product Overview : | Recombinant Human SH3BGRL3 protein(1-93 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-93 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SH3BGRL3 SH3 domain binding glutamic acid-rich protein like 3 [ Homo sapiens ] |
Official Symbol | SH3BGRL3 |
Synonyms | TIP-B1; SH3BP-1 |
Gene ID | 83442 |
mRNA Refseq | NM_031286.3 |
Protein Refseq | NP_112576.1 |
UniProt ID | Q9H299 |
◆ Recombinant Proteins | ||
SH3BGRL3-15065M | Recombinant Mouse SH3BGRL3 Protein | +Inquiry |
SH3BGRL3-7147H | Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 3, His-tagged | +Inquiry |
SH3BGRL3-1227H | Recombinant Human SH3BGRL3 protein, GST-tagged | +Inquiry |
SH3BGRL3-5598C | Recombinant Chicken SH3BGRL3 | +Inquiry |
SH3BGRL3-3117H | Recombinant Human SH3BGRL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3BGRL3-1873HCL | Recombinant Human SH3BGRL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3BGRL3 Products
Required fields are marked with *
My Review for All SH3BGRL3 Products
Required fields are marked with *
0
Inquiry Basket