Recombinant Human SH3BGRL3 protein, GST-tagged

• Cat.No.: SH3BGRL3-1227H
• Product Overview: Recombinant Human SH3BGRL3 protein(1-93 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-93 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SH3BGRL3 SH3 domain binding glutamic acid-rich protein like 3 [ Homo sapiens ]
• Official Symbol: SH3BGRL3
• Synonyms: TIP-B1; SH3BP-1
• Gene ID: 83442
• mRNA Refseq: NM_031286.3
• Protein Refseq: NP_112576.1
• UniProt ID: Q9H299