Recombinant Human SH3BGRL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SH3BGRL3-3117H |
| Product Overview : | SH3BGRL3 MS Standard C13 and N15-labeled recombinant protein (NP_112576) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Could act as a modulator of glutaredoxin biological activity. |
| Molecular Mass : | 10.4 kDa |
| AA Sequence : | MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SH3BGRL3 SH3 domain binding glutamic acid-rich protein like 3 [ Homo sapiens (human) ] |
| Official Symbol | SH3BGRL3 |
| Synonyms | SH3BGRL3; SH3 domain binding glutamate rich protein like 3; TIP-B1; SH3BP-1; HEL-S-297; SH3 domain-binding glutamic acid-rich-like protein 3; SH3 domain binding glutamic acid-rich protein like 3; SH3 domain-binding protein 1; SH3BGRL3-like protein; TNF inhibitory protein; epididymis secretory protein Li 297; epididymis secretory sperm binding protein |
| Gene ID | 83442 |
| mRNA Refseq | NM_031286 |
| Protein Refseq | NP_112576 |
| MIM | 615679 |
| UniProt ID | Q9H299 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3BGRL3 Products
Required fields are marked with *
My Review for All SH3BGRL3 Products
Required fields are marked with *



