Recombinant Human SH3BGRL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SH3BGRL3-3117H |
Product Overview : | SH3BGRL3 MS Standard C13 and N15-labeled recombinant protein (NP_112576) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Could act as a modulator of glutaredoxin biological activity. |
Molecular Mass : | 10.4 kDa |
AA Sequence : | MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SH3BGRL3 SH3 domain binding glutamic acid-rich protein like 3 [ Homo sapiens (human) ] |
Official Symbol | SH3BGRL3 |
Synonyms | SH3BGRL3; SH3 domain binding glutamate rich protein like 3; TIP-B1; SH3BP-1; HEL-S-297; SH3 domain-binding glutamic acid-rich-like protein 3; SH3 domain binding glutamic acid-rich protein like 3; SH3 domain-binding protein 1; SH3BGRL3-like protein; TNF inhibitory protein; epididymis secretory protein Li 297; epididymis secretory sperm binding protein |
Gene ID | 83442 |
mRNA Refseq | NM_031286 |
Protein Refseq | NP_112576 |
MIM | 615679 |
UniProt ID | Q9H299 |
◆ Recombinant Proteins | ||
SH3BGRL3-5598C | Recombinant Chicken SH3BGRL3 | +Inquiry |
SH3BGRL3-3117H | Recombinant Human SH3BGRL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SH3BGRL3-1227H | Recombinant Human SH3BGRL3 protein, GST-tagged | +Inquiry |
SH3BGRL3-10612Z | Recombinant Zebrafish SH3BGRL3 | +Inquiry |
SH3BGRL3-8123M | Recombinant Mouse SH3BGRL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3BGRL3-1873HCL | Recombinant Human SH3BGRL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH3BGRL3 Products
Required fields are marked with *
My Review for All SH3BGRL3 Products
Required fields are marked with *
0
Inquiry Basket