Recombinant Human SH3BGRL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SH3BGRL3-3117H
• Product Overview: SH3BGRL3 MS Standard C13 and N15-labeled recombinant protein (NP_112576) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Could act as a modulator of glutaredoxin biological activity.
• Molecular Mass: 10.4 kDa
• AA Sequence: MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SH3BGRL3 SH3 domain binding glutamic acid-rich protein like 3 [ Homo sapiens (human) ]
• Official Symbol: SH3BGRL3
• Synonyms: SH3BGRL3; SH3 domain binding glutamate rich protein like 3; TIP-B1; SH3BP-1; HEL-S-297; SH3 domain-binding glutamic acid-rich-like protein 3; SH3 domain binding glutamic acid-rich protein like 3; SH3 domain-binding protein 1; SH3BGRL3-like protein; TNF inhibitory protein; epididymis secretory protein Li 297; epididymis secretory sperm binding protein
• Gene ID: 83442
• mRNA Refseq: NM_031286
• Protein Refseq: NP_112576
• MIM: 615679
• UniProt ID: Q9H299