Recombinant Human SH3BGRL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SH3BGRL3-3117H
Product Overview : SH3BGRL3 MS Standard C13 and N15-labeled recombinant protein (NP_112576) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Could act as a modulator of glutaredoxin biological activity.
Molecular Mass : 10.4 kDa
AA Sequence : MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SH3BGRL3 SH3 domain binding glutamic acid-rich protein like 3 [ Homo sapiens (human) ]
Official Symbol SH3BGRL3
Synonyms SH3BGRL3; SH3 domain binding glutamate rich protein like 3; TIP-B1; SH3BP-1; HEL-S-297; SH3 domain-binding glutamic acid-rich-like protein 3; SH3 domain binding glutamic acid-rich protein like 3; SH3 domain-binding protein 1; SH3BGRL3-like protein; TNF inhibitory protein; epididymis secretory protein Li 297; epididymis secretory sperm binding protein
Gene ID 83442
mRNA Refseq NM_031286
Protein Refseq NP_112576
MIM 615679
UniProt ID Q9H299

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH3BGRL3 Products

Required fields are marked with *

My Review for All SH3BGRL3 Products

Required fields are marked with *

0
cart-icon