Recombinant Human SH3GL2
| Cat.No. : | SH3GL2-30063TH |
| Product Overview : | Recombinant fragment of Human SH3GL2 with proprietary tag at N-terminal; Predicted MW 56.8kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 279 amino acids |
| Description : | Endophilin-A1 is a protein that in humans is encoded by the SH3GL2 gene. |
| Molecular Weight : | 56.800kDa inclusive of tags |
| Tissue specificity : | Brain, mostly in frontal cortex. Expressed at high level in fetal cerebellum. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKV DVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQ GKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKK LEGRRLDFDYKKERQGKIPDEELHQALEKFDESKEIAESS MFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSH |
| Sequence Similarities : | Belongs to the endophilin family.Contains 1 BAR domain.Contains 1 SH3 domain. |
| Gene Name | SH3GL2 SH3-domain GRB2-like 2 [ Homo sapiens ] |
| Official Symbol | SH3GL2 |
| Synonyms | SH3GL2; SH3-domain GRB2-like 2; endophilin-A1; CNSA2; EEN B1; SH3D2A; SH3P4; |
| Gene ID | 6456 |
| mRNA Refseq | NM_003026 |
| Protein Refseq | NP_003017 |
| MIM | 604465 |
| Uniprot ID | Q99962 |
| Chromosome Location | 9p22 |
| Pathway | Axon guidance, organism-specific biosystem; Clathrin derived vesicle budding, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EGFR downregulation, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; |
| Function | identical protein binding; lipid binding; protein binding; |
| ◆ Recombinant Proteins | ||
| SH3GL2-6099C | Recombinant Chicken SH3GL2 | +Inquiry |
| SH3GL2-5038R | Recombinant Rat SH3GL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SH3GL2-15072M | Recombinant Mouse SH3GL2 Protein | +Inquiry |
| SH3GL2-386H | Recombinant Human SH3GL2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SH3GL2-11338Z | Recombinant Zebrafish SH3GL2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SH3GL2-1867HCL | Recombinant Human SH3GL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3GL2 Products
Required fields are marked with *
My Review for All SH3GL2 Products
Required fields are marked with *
