Recombinant Human SH3GL2
| Cat.No. : | SH3GL2-30063TH | 
| Product Overview : | Recombinant fragment of Human SH3GL2 with proprietary tag at N-terminal; Predicted MW 56.8kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 279 amino acids | 
| Description : | Endophilin-A1 is a protein that in humans is encoded by the SH3GL2 gene. | 
| Molecular Weight : | 56.800kDa inclusive of tags | 
| Tissue specificity : | Brain, mostly in frontal cortex. Expressed at high level in fetal cerebellum. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKV DVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQ GKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKK LEGRRLDFDYKKERQGKIPDEELHQALEKFDESKEIAESS MFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSH | 
| Sequence Similarities : | Belongs to the endophilin family.Contains 1 BAR domain.Contains 1 SH3 domain. | 
| Gene Name | SH3GL2 SH3-domain GRB2-like 2 [ Homo sapiens ] | 
| Official Symbol | SH3GL2 | 
| Synonyms | SH3GL2; SH3-domain GRB2-like 2; endophilin-A1; CNSA2; EEN B1; SH3D2A; SH3P4; | 
| Gene ID | 6456 | 
| mRNA Refseq | NM_003026 | 
| Protein Refseq | NP_003017 | 
| MIM | 604465 | 
| Uniprot ID | Q99962 | 
| Chromosome Location | 9p22 | 
| Pathway | Axon guidance, organism-specific biosystem; Clathrin derived vesicle budding, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EGFR downregulation, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; | 
| Function | identical protein binding; lipid binding; protein binding; | 
| ◆ Recombinant Proteins | ||
| Sh3gl2-5845M | Recombinant Mouse Sh3gl2 Protein, Myc/DDK-tagged | +Inquiry | 
| SH3GL2-30062TH | Recombinant Human SH3GL2 | +Inquiry | 
| SH3GL2-277H | Recombinant Human SH3GL2 Protein, DDK-tagged | +Inquiry | 
| SH3GL2-5587H | Recombinant Human SH3-Domain GRB2-Like 2, His-tagged | +Inquiry | 
| SH3GL2-15846H | Recombinant Human SH3GL2, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SH3GL2-1867HCL | Recombinant Human SH3GL2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3GL2 Products
Required fields are marked with *
My Review for All SH3GL2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            