Recombinant Human SHBG protein, His-tagged
Cat.No. : | SHBG-3742H |
Product Overview : | Recombinant human SHBG was expressed in CHO cells with C-Terminal His-tag + myc-epitope. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | His |
Protein Length : | 428 AA |
Description : | Sex-hormone-binding globulin (SHBG) is a beta-globulin that specifically binds steroid hormones. Its molecular weight is 86 kDa/mol. The major site of SHBG synthesis is thought to be the hepatocytes. Its production is regulated by androgen/estrogen balance, thyroid hormones, insulin and dietary factors, among others. SHBG is involved in the transport of sex steroids in plasma. Its concentration is a major factor regulating their distribution between protein-bound and free states. Determination of SHBG concentration is mainly of importance in the evaluation of mild disorders of androgen metabolism and it allows identification of women with hirsutism who are likely to respond to estrogen therapy. Testosterone/SHBG-ratios correlate well with both measured and calculated values for free testosterone, and help to discriminate between subjects with excessive androgen activity and normal individuals. |
Form : | Frozen, stabilized and concentrated medium |
Molecular Mass : | 46.79 kDa (calculated); 94kDa (forms a dimer) |
AA Sequence : | AAQPARRARRTKLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASHSRGGPEQKLISEEDLNSAVDHHHHHH |
Applications : | ELISA standard; Standard for Immunoanalytical methods |
Notes : | This product is intended for research use only. |
Storage : | Store at -80 centigrade. |
Gene Name | Sex hormone binding globulin [Homo sapiens (human)] |
Official Symbol | SHBG |
Synonyms | ABP; SBP; TEBG; SHBG, Sex steroid-binding protein; Testisspecific androgen-binding protein; Testosterone-estradiolbinding globulin; Testosterone-estrogen-binding globulin |
Gene ID | 6462 |
mRNA Refseq | NM_001040.3 |
Protein Refseq | NP_001031.2 |
MIM | 182205 |
UniProt ID | P04278 |
◆ Recombinant Proteins | ||
Shbg-50R | Recombinant Rat Shbg protein, His-tagged | +Inquiry |
SHBG-8140M | Recombinant Mouse SHBG Protein, His (Fc)-Avi-tagged | +Inquiry |
SHBG-505H | Recombinant Human SHBG protein, His-tagged | +Inquiry |
Shbg-12M | Recombinant Mouse Shbg protein, His-tagged | +Inquiry |
SHBG-1228H | Recombinant Human SHBG Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHBG Products
Required fields are marked with *
My Review for All SHBG Products
Required fields are marked with *
0
Inquiry Basket