Recombinant Human SHBG protein, His-tagged

Cat.No. : SHBG-3742H
Product Overview : Recombinant human SHBG was expressed in CHO cells with C-Terminal His-tag + myc-epitope.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : His
Protein Length : 428 AA
Description : Sex-hormone-binding globulin (SHBG) is a beta-globulin that specifically binds steroid hormones. Its molecular weight is 86 kDa/mol. The major site of SHBG synthesis is thought to be the hepatocytes. Its production is regulated by androgen/estrogen balance, thyroid hormones, insulin and dietary factors, among others. SHBG is involved in the transport of sex steroids in plasma. Its concentration is a major factor regulating their distribution between protein-bound and free states. Determination of SHBG concentration is mainly of importance in the evaluation of mild disorders of androgen metabolism and it allows identification of women with hirsutism who are likely to respond to estrogen therapy. Testosterone/SHBG-ratios correlate well with both measured and calculated values for free testosterone, and help to discriminate between subjects with excessive androgen activity and normal individuals.
Form : Frozen, stabilized and concentrated medium
Molecular Mass : 46.79 kDa (calculated); 94kDa (forms a dimer)
AA Sequence : AAQPARRARRTKLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASHSRGGPEQKLISEEDLNSAVDHHHHHH
Applications : ELISA standard; Standard for Immunoanalytical methods
Notes : This product is intended for research use only.
Storage : Store at -80 centigrade.
Gene Name Sex hormone binding globulin [Homo sapiens (human)]
Official Symbol SHBG
Synonyms ABP; SBP; TEBG; SHBG, Sex steroid-binding protein; Testisspecific androgen-binding protein; Testosterone-estradiolbinding globulin; Testosterone-estrogen-binding globulin
Gene ID 6462
mRNA Refseq NM_001040.3
Protein Refseq NP_001031.2
MIM 182205
UniProt ID P04278

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SHBG Products

Required fields are marked with *

My Review for All SHBG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon