Recombinant Human SHMT1, His-tagged
Cat.No. : | SHMT1-31357TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 184-483 of Human SHMT1, with N terminal His tag, 300aa, MWt 35kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 184-483 a.a. |
Description : | This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGA YLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRG CRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPG LQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRA LSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVL EACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLE KDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLA GDKYQAAVQALREEVESFASLFPLPGLPDF |
Sequence Similarities : | Belongs to the SHMT family. |
Gene Name | SHMT1 serine hydroxymethyltransferase 1 (soluble) [ Homo sapiens ] |
Official Symbol | SHMT1 |
Synonyms | SHMT1; serine hydroxymethyltransferase 1 (soluble); serine hydroxymethyltransferase, cytosolic; 14 kDa protein; CSHMT; cytoplasmic serine hydroxymethyltransferase; MGC15229; MGC24556; SHMT; |
Gene ID | 6470 |
mRNA Refseq | NM_004169 |
Protein Refseq | NP_004160 |
MIM | 182144 |
Uniprot ID | P34896 |
Chromosome Location | 17p11.2 |
Pathway | C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Carnitine synthesis, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem; |
Function | L-allo-threonine aldolase activity; amino acid binding; glycine hydroxymethyltransferase activity; glycine hydroxymethyltransferase activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
SHMT1-1542H | Recombinant Human Serine Hydroxymethyltransferase 1, His-tagged | +Inquiry |
SHMT1-2661H | Recombinant Human SHMT1 protein, GST-tagged | +Inquiry |
SHMT1-8158M | Recombinant Mouse SHMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHMT1-4012R | Recombinant Rhesus Macaque SHMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHMT1-7855H | Recombinant Human SHMT1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHMT1-1854HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
SHMT1-1855HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHMT1 Products
Required fields are marked with *
My Review for All SHMT1 Products
Required fields are marked with *
0
Inquiry Basket