Recombinant Human SHOC2 protein, GST-tagged
Cat.No. : | SHOC2-2664H |
Product Overview : | Recombinant Human SHOC2(1 a.a. - 582 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-582 a.a. |
Description : | This gene encodes a protein that consists almost entirely of leucine-rich repeats, a domain implicated in protein-protein interactions. The protein may function as a scaffold linking RAS to downstream signal transducers in the RAS/ERK MAP kinase signaling cascade. Mutations in this gene have been associated with Noonan-like syndrome with loose anagen hair. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 89.76 kDa |
AA Sequence : | MSSSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDNTIKRP NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIEELTQLTELYLYSNKLQSLPAEVGCLVNLMT LALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIREN KIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIP RSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIF SRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKL RELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLN DNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SHOC2 SHOC2 leucine-rich repeat scaffold protein [ Homo sapiens ] |
Official Symbol | SHOC2 |
Synonyms | SOC2; SUR8; SIAA0862; soc-2 suppressor of clear homolog |
Gene ID | 8036 |
mRNA Refseq | NM_007373 |
Protein Refseq | NP_031399 |
MIM | 602775 |
UniProt ID | Q9UQ13 |
Chromosome Location | 10q25 |
Pathway | EGFR1 Signaling Pathway, organism-specific biosystem |
Function | protein phosphatase binding; protein phosphatase regulator activity |
◆ Recombinant Proteins | ||
Shoc2-5869M | Recombinant Mouse Shoc2 Protein, Myc/DDK-tagged | +Inquiry |
SHOC2-8159M | Recombinant Mouse SHOC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHOC2-3889HFL | Recombinant Full Length Human SHOC2 leucine rich repeat scaffold protein protein, His-tagged | +Inquiry |
SHOC2-604HF | Recombinant Full Length Human SHOC2 Protein, GST-tagged | +Inquiry |
SHOC2-2663H | Recombinant Human SHOC2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHOC2-1852HCL | Recombinant Human SHOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHOC2 Products
Required fields are marked with *
My Review for All SHOC2 Products
Required fields are marked with *
0
Inquiry Basket