Recombinant Human SHOX2
Cat.No. : | SHOX2-31358TH |
Product Overview : | Recombinant fragment corresponding to amino acids 117-204 of Human SHOX2 with proprietary tag; Predicted MWt 35.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 88 amino acids |
Description : | This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 35.310kDa inclusive of tags |
Tissue specificity : | Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK |
Sequence Similarities : | Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name | SHOX2 short stature homeobox 2 [ Homo sapiens ] |
Official Symbol | SHOX2 |
Synonyms | SHOX2; short stature homeobox 2; short stature homeobox protein 2; OG12; OG12X; SHOT; |
Gene ID | 6474 |
mRNA Refseq | NM_001163678 |
Protein Refseq | NP_001157150 |
MIM | 602504 |
Uniprot ID | O60902 |
Chromosome Location | 3q25.32 |
Function | transcription regulatory region sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
SHOX2-5395R | Recombinant Rat SHOX2 Protein | +Inquiry |
SHOX2-15111M | Recombinant Mouse SHOX2 Protein | +Inquiry |
SHOX2-11413Z | Recombinant Zebrafish SHOX2 | +Inquiry |
SHOX2-31358TH | Recombinant Human SHOX2 | +Inquiry |
SHOX2-2665H | Recombinant Human SHOX2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHOX2-1604HCL | Recombinant Human SHOX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SHOX2 Products
Required fields are marked with *
My Review for All SHOX2 Products
Required fields are marked with *
0
Inquiry Basket