Recombinant Human SHOX2

Cat.No. : SHOX2-31358TH
Product Overview : Recombinant fragment corresponding to amino acids 117-204 of Human SHOX2 with proprietary tag; Predicted MWt 35.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 88 amino acids
Description : This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants.
Molecular Weight : 35.310kDa inclusive of tags
Tissue specificity : Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Sequence Similarities : Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name SHOX2 short stature homeobox 2 [ Homo sapiens ]
Official Symbol SHOX2
Synonyms SHOX2; short stature homeobox 2; short stature homeobox protein 2; OG12; OG12X; SHOT;
Gene ID 6474
mRNA Refseq NM_001163678
Protein Refseq NP_001157150
MIM 602504
Uniprot ID O60902
Chromosome Location 3q25.32
Function transcription regulatory region sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SHOX2 Products

Required fields are marked with *

My Review for All SHOX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon