Recombinant Human SHQ1 protein, His-tagged
Cat.No. : | SHQ1-2579H |
Product Overview : | Recombinant Human SHQ1 protein(1-214 aa), fused to His tag, was expressed in E. coli. |
Availability | June 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-214 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTALLAPRKSRTAKPLVEEIGASEIPEEVVDDEEFDWEIEQTPCEEVSESALNPQCHYGFGNLRSGVLQRLQDELSDVIDIKDPDFTPAAERRQKRLAAELAKFDPDHYLADFFEDEAIEQILK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SHQ1 SHQ1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SHQ1 |
Synonyms | SHQ1; SHQ1 homolog (S. cerevisiae); protein SHQ1 homolog; FLJ10539; Shq1p; DKFZp686H07226; |
Gene ID | 55164 |
mRNA Refseq | NM_018130 |
Protein Refseq | NP_060600 |
MIM | 613663 |
UniProt ID | Q6PI26 |
◆ Recombinant Proteins | ||
SHQ1-2579H | Recombinant Human SHQ1 protein, His-tagged | +Inquiry |
SHQ1-8162M | Recombinant Mouse SHQ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Shq1-5871M | Recombinant Mouse Shq1 Protein, Myc/DDK-tagged | +Inquiry |
SHQ1-5096Z | Recombinant Zebrafish SHQ1 | +Inquiry |
SHQ1-15114M | Recombinant Mouse SHQ1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHQ1 Products
Required fields are marked with *
My Review for All SHQ1 Products
Required fields are marked with *
0
Inquiry Basket