Recombinant Human SIGLEC15 protein, His-SUMO-tagged

Cat.No. : SIGLEC15-10H
Product Overview : Recombinant Human SIGLEC15 protein is produced by E.coli expression system and fused with a 6×His-SUMO tag at the N-terminal. This protien is a binds sialylated glycoproteins
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 20-263 aa
Molecular Mass : 42.6 kDa
AA Sequence : FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Endotoxin : ﹤1.0 EU per 1μg cytokine as determined by the LAL method.
Purity : Greater than 90 % as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Storage Buffer : Tris-based buffer,50 % glycerol
Gene Name SIGLEC15 sialic acid binding Ig like lectin 15 [ Homo sapiens (human) ]
Official Symbol SIGLEC15
Synonyms CD33L3; HsT1361; SIGLEC-15; CD33 antigen-like 3; CD33 molecule-like 3
Gene ID 284266
mRNA Refseq NM_213602.2
Protein Refseq NP_998767.1
UniProt ID Q6ZMC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIGLEC15 Products

Required fields are marked with *

My Review for All SIGLEC15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon