Recombinant Human SIGLEC15 protein, His-SUMO-tagged
Cat.No. : | SIGLEC15-10H |
Product Overview : | Recombinant Human SIGLEC15 protein is produced by E.coli expression system and fused with a 6×His-SUMO tag at the N-terminal. This protien is a binds sialylated glycoproteins |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-263 aa |
Molecular Mass : | 42.6 kDa |
AA Sequence : | FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST |
Endotoxin : | ﹤1.0 EU per 1μg cytokine as determined by the LAL method. |
Purity : | Greater than 90 % as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Storage Buffer : | Tris-based buffer,50 % glycerol |
Gene Name | SIGLEC15 sialic acid binding Ig like lectin 15 [ Homo sapiens (human) ] |
Official Symbol | SIGLEC15 |
Synonyms | CD33L3; HsT1361; SIGLEC-15; CD33 antigen-like 3; CD33 molecule-like 3 |
Gene ID | 284266 |
mRNA Refseq | NM_213602.2 |
Protein Refseq | NP_998767.1 |
UniProt ID | Q6ZMC9 |
◆ Recombinant Proteins | ||
SIGLEC15-727H | Recombinant Human SIGLEC15 Protein (Phe20-Thr263), C-mFc and 6×His-tagged | +Inquiry |
SIGLEC15-0678H | Active Recombinant Human SIGLEC15 protein, Fc-tagged | +Inquiry |
SIGLEC15-170H | Recombinant Human SIGLEC15 protein, His-Avi-tagged | +Inquiry |
Siglec15-4633M | Recombinant Mouse Siglec15 protein, His-tagged | +Inquiry |
SIGLEC15-2371M | Recombinant Mouse SIGLEC15 protein(Met1-Thr262), rFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLEC15-1847HCL | Recombinant Human SIGLEC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIGLEC15 Products
Required fields are marked with *
My Review for All SIGLEC15 Products
Required fields are marked with *
0
Inquiry Basket