Recombinant Human SIGLEC15 protein, His-SUMO-tagged

• Cat.No.: SIGLEC15-10H
• Product Overview: Recombinant Human SIGLEC15 protein is produced by E.coli expression system and fused with a 6×His-SUMO tag at the N-terminal. This protien is a binds sialylated glycoproteins

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 20-263 aa
• Molecular Mass: 42.6 kDa
• AA Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
• Endotoxin: ﹤1.0 EU per 1μg cytokine as determined by the LAL method.
• Purity: Greater than 90 % as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
  Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Storage Buffer: Tris-based buffer,50 % glycerol

Gene Information

• Gene Name: SIGLEC15 sialic acid binding Ig like lectin 15 [ Homo sapiens (human) ]
• Official Symbol: SIGLEC15
• Synonyms: CD33L3; HsT1361; SIGLEC-15; CD33 antigen-like 3; CD33 molecule-like 3
• Gene ID: 284266
• mRNA Refseq: NM_213602.2
• Protein Refseq: NP_998767.1
• UniProt ID: Q6ZMC9