Recombinant Human SIGLEC9 Protein, His-tagged
Cat.No. : | SIGLEC9-051H |
Product Overview : | Recombinant Human SIGLEC9 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Two families of mammalian lectin-like adhesion molecules bind glycoconjugate ligands in a sialic acid-dependent manner: the selectins and the sialoadhesins. The sialic acid-binding immunoglobulin superfamily lectins, designated siglecs or sialoadhesins, are immunoglobulin superfamily members recognizing sialylated ligands. The common sialic acids of mammalian cells are N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc). Siglec-1 mediates local cell-cell interactions in lymphoid tissues and can be detected at contact points of macrophages with other macrophages, sinus-lining cells and reticulum cells. Siglec-7, highly expressed in monocytes and resident blood cells but not in parenchymatous cells, mediates inhibition of natural killer cell cytotoxicity. Siglec-9 is closely homologous to Siglec-7. It is highly expressed in peripheral blood leukocytes (not eosinophils), liver, bone marrow, placenta and spleen. Siglec-8, a type I membrane protein, is selectively expressed on human eosinophils, basophils and mast cells, where it regulates their function and survival. |
Molecular Mass : | ~42 kDa |
AA Sequence : | SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | SIGLEC9 sialic acid binding Ig-like lectin 9 [ Homo sapiens (human) ] |
Official Symbol | SIGLEC9 |
Synonyms | SIGLEC9; sialic acid binding Ig-like lectin 9; sialic acid-binding Ig-like lectin 9; CD329; protein FOAP-9; CDw329; FOAP-9; siglec-9; OBBP-LIKE; |
Gene ID | 27180 |
mRNA Refseq | NM_001198558 |
Protein Refseq | NP_001185487 |
MIM | 605640 |
UniProt ID | Q9Y336 |
◆ Recombinant Proteins | ||
SIGLEC9-676H | Active Recombinant Human SIGLEC9, Fc-tagged, Biotinylated | +Inquiry |
SIGLEC9-051H | Recombinant Human SIGLEC9 Protein, His-tagged | +Inquiry |
SIGLEC9-1749R | Recombinant Rhesus Monkey SIGLEC9 Protein | +Inquiry |
SIGLEC9-2012H | Recombinant Human SIGLEC9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGLEC9-1414H | Recombinant Human SIGLEC9 Protein (Met25-Leu142), N-His tagged | +Inquiry |
◆ Native Proteins | ||
SIGLEC9-57H | Active Recombinant Human SIGLEC9 Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLEC9-1844HCL | Recombinant Human SIGLEC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGLEC9 Products
Required fields are marked with *
My Review for All SIGLEC9 Products
Required fields are marked with *