Recombinant Human SIGLEC9 Protein, His-tagged
| Cat.No. : | SIGLEC9-051H |
| Product Overview : | Recombinant Human SIGLEC9 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Two families of mammalian lectin-like adhesion molecules bind glycoconjugate ligands in a sialic acid-dependent manner: the selectins and the sialoadhesins. The sialic acid-binding immunoglobulin superfamily lectins, designated siglecs or sialoadhesins, are immunoglobulin superfamily members recognizing sialylated ligands. The common sialic acids of mammalian cells are N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc). Siglec-1 mediates local cell-cell interactions in lymphoid tissues and can be detected at contact points of macrophages with other macrophages, sinus-lining cells and reticulum cells. Siglec-7, highly expressed in monocytes and resident blood cells but not in parenchymatous cells, mediates inhibition of natural killer cell cytotoxicity. Siglec-9 is closely homologous to Siglec-7. It is highly expressed in peripheral blood leukocytes (not eosinophils), liver, bone marrow, placenta and spleen. Siglec-8, a type I membrane protein, is selectively expressed on human eosinophils, basophils and mast cells, where it regulates their function and survival. |
| Molecular Mass : | ~42 kDa |
| AA Sequence : | SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | SIGLEC9 sialic acid binding Ig-like lectin 9 [ Homo sapiens (human) ] |
| Official Symbol | SIGLEC9 |
| Synonyms | SIGLEC9; sialic acid binding Ig-like lectin 9; sialic acid-binding Ig-like lectin 9; CD329; protein FOAP-9; CDw329; FOAP-9; siglec-9; OBBP-LIKE; |
| Gene ID | 27180 |
| mRNA Refseq | NM_001198558 |
| Protein Refseq | NP_001185487 |
| MIM | 605640 |
| UniProt ID | Q9Y336 |
| ◆ Recombinant Proteins | ||
| SIGLEC9-6068H | Recombinant Human SIGLEC9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SIGLEC9-0735H | Active Recombinant Human SIGLEC9 protein, His-tagged | +Inquiry |
| SIGLEC9-0732H | Recombinant Human SIGLEC9 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| SIGLEC9-051H | Recombinant Human SIGLEC9 Protein, His-tagged | +Inquiry |
| SIGLEC9-146H | Recombinant Human SIGLEC9 protein, His-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIGLEC9-1844HCL | Recombinant Human SIGLEC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGLEC9 Products
Required fields are marked with *
My Review for All SIGLEC9 Products
Required fields are marked with *
