Recombinant Human signal transducer and activator of transcription 2, 113kDa Protein, His tagged
| Cat.No. : | STAT2-01H |
| Product Overview : | Recombinant Human STAT2 Protein (679-851aa) with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 679-851aa |
| Description : | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44. |
| Tag : | C-His |
| Molecular Mass : | 21 kDa |
| AA Sequence : | MQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDFHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Storage Buffer : | Sterile PBS, pH7.4. |
| Gene Name | STAT2 signal transducer and activator of transcription 2, 113kDa [Homo sapiens (human)] |
| Official Symbol | STAT2 |
| Synonyms | STAT2; signal transducer and activator of transcription 2, 113kDa; signal transducer and activator of transcription 2, 113kD; signal transducer and activator of transcription 2; STAT113; interferon alpha induced transcriptional activator; P113; ISGF-3; MGC59816 |
| Gene ID | 6773 |
| mRNA Refseq | NM_005419 |
| Protein Refseq | NP_005410 |
| MIM | 600556 |
| UniProt ID | P52630 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAT2 Products
Required fields are marked with *
My Review for All STAT2 Products
Required fields are marked with *
