Recombinant Human SIK2 protein, His-tagged

• Cat.No.: SIK2-7854H
• Product Overview: Recombinant Human SIK2 protein(250-400 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 250-400 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: RMLVLDPSKRLTIAQIKEHKWMLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFS
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SIK2 salt-inducible kinase 2 [ Homo sapiens ]
• Official Symbol: SIK2
• Synonyms: SIK2; salt-inducible kinase 2; SNF1 like kinase 2 , SNF1LK2; serine/threonine-protein kinase SIK2; DKFZp434K1115; KIAA0781; LOH11CR1I; QIK; SIK-2; SNF1-like kinase 2; qin-induced kinase; salt-inducible protein kinase 2; salt-inducible serine/threonine kinase 2; serine/threonine-protein kinase SNF1-like kinase 2; SNF1LK2
• Gene ID: 23235
• mRNA Refseq: NM_015191
• Protein Refseq: NP_056006
• MIM: 608973
• UniProt ID: Q9H0K1