Recombinant Human SIK2 protein, His-tagged
Cat.No. : | SIK2-7854H |
Product Overview : | Recombinant Human SIK2 protein(250-400 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 250-400 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | RMLVLDPSKRLTIAQIKEHKWMLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFS |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SIK2 salt-inducible kinase 2 [ Homo sapiens ] |
Official Symbol | SIK2 |
Synonyms | SIK2; salt-inducible kinase 2; SNF1 like kinase 2 , SNF1LK2; serine/threonine-protein kinase SIK2; DKFZp434K1115; KIAA0781; LOH11CR1I; QIK; SIK-2; SNF1-like kinase 2; qin-induced kinase; salt-inducible protein kinase 2; salt-inducible serine/threonine kinase 2; serine/threonine-protein kinase SNF1-like kinase 2; SNF1LK2; |
Gene ID | 23235 |
mRNA Refseq | NM_015191 |
Protein Refseq | NP_056006 |
MIM | 608973 |
UniProt ID | Q9H0K1 |
◆ Recombinant Proteins | ||
SIK2-7854H | Recombinant Human SIK2 protein, His-tagged | +Inquiry |
SIK2-3156H | Recombinant Human SIK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sik2-5878M | Recombinant Mouse Sik2 Protein, Myc/DDK-tagged | +Inquiry |
SIK2-1478H | Active Recombinant Human QIK, GST-tagged | +Inquiry |
SIK2-415H | Recombinant Human Salt-inducible Kinase 2, GST-tagged, Active | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIK2-1841HCL | Recombinant Human SIK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIK2 Products
Required fields are marked with *
My Review for All SIK2 Products
Required fields are marked with *