Recombinant Human SIK2 protein, His-tagged

Cat.No. : SIK2-7854H
Product Overview : Recombinant Human SIK2 protein(250-400 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 250-400 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : RMLVLDPSKRLTIAQIKEHKWMLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFS
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name SIK2 salt-inducible kinase 2 [ Homo sapiens ]
Official Symbol SIK2
Synonyms SIK2; salt-inducible kinase 2; SNF1 like kinase 2 , SNF1LK2; serine/threonine-protein kinase SIK2; DKFZp434K1115; KIAA0781; LOH11CR1I; QIK; SIK-2; SNF1-like kinase 2; qin-induced kinase; salt-inducible protein kinase 2; salt-inducible serine/threonine kinase 2; serine/threonine-protein kinase SNF1-like kinase 2; SNF1LK2;
Gene ID 23235
mRNA Refseq NM_015191
Protein Refseq NP_056006
MIM 608973
UniProt ID Q9H0K1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIK2 Products

Required fields are marked with *

My Review for All SIK2 Products

Required fields are marked with *

0
cart-icon
0
compare icon