"SIRT2" Related Products

Expand
Expand
Expand

Recombinant Human SIRT2 protein, T7/His-tagged

Cat.No.: SIRT2-174H
Product Overview: Recombinant human SIRT2 cDNA (389aa, isoform-2) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVG AGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKG LLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVF FGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDF DSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTE REKPQ
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: SIRT2 sirtuin 2 [ Homo sapiens ]
Official Symbol: SIRT2
Synonyms: SIRT2; sirtuin 2; NAD-dependent deacetylase sirtuin-2; sirtuin type 2; SIR2-like protein 2; SIR2; SIR2L; SIR2L2; FLJ35621; FLJ37491;
Gene ID: 22933
mRNA Refseq: NM_030593
Protein Refseq: NP_085096
MIM: 604480
UniProt ID: Q8IXJ6
Chromosome Location: 19q13
Pathway: Signaling events mediated by HDAC Class I, organism-specific biosystem; Signaling events mediated by HDAC Class III, organism-specific biosystem;
Function: NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; histone acetyltransferase binding; histone deacetylase binding; hydrolase activity; metal ion binding; protein binding; protein deacetylase activity; transcription factor binding; tubulin deacetylase activity; ubiquitin binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.