Recombinant Human SIRT2 protein, T7/His-tagged
Cat.No. : | SIRT2-174H |
Product Overview : | Recombinant human SIRT2 cDNA (389aa, isoform-2) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 389 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVG AGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKG LLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVF FGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDF DSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTE REKPQ |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | SIRT2 sirtuin 2 [ Homo sapiens ] |
Official Symbol | SIRT2 |
Synonyms | SIRT2; sirtuin 2; NAD-dependent deacetylase sirtuin-2; sirtuin type 2; SIR2-like protein 2; SIR2; SIR2L; SIR2L2; FLJ35621; FLJ37491; |
Gene ID | 22933 |
mRNA Refseq | NM_030593 |
Protein Refseq | NP_085096 |
MIM | 604480 |
UniProt ID | Q8IXJ6 |
Chromosome Location | 19q13 |
Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; Signaling events mediated by HDAC Class III, organism-specific biosystem; |
Function | NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; histone acetyltransferase binding; histone deacetylase binding; hydrolase activity; metal ion binding; protein binding; protein deacetylase activity; transcription factor binding; tubulin deacetylase activity; ubiquitin binding; zinc ion binding; |
◆ Recombinant Proteins | ||
SIRT2-15152M | Recombinant Mouse SIRT2 Protein | +Inquiry |
Sirt2-648M | Recombinant Mouse Sirt2 Protein, His-tagged | +Inquiry |
SIRT2-30567TH | Recombinant Human SIRT2, His-tagged | +Inquiry |
SIRT2-5758H | Recombinant Human SIRT2 Protein | +Inquiry |
SIRT2-5759H | Recombinant Full Length Human SIRT2 Protein (Met1-Gln389), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT2-1834HCL | Recombinant Human SIRT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT2 Products
Required fields are marked with *
My Review for All SIRT2 Products
Required fields are marked with *