Recombinant Human SIRT6 protein, T7/His-tagged
Cat.No. : | SIRT6-213H |
Product Overview : | Recombinant human SIRT6 cDNA (355 aa, Isoform_1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSV VFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRS GFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDL ALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLE IPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKR VKAKAVPS |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | SIRT6 sirtuin 6 [ Homo sapiens ] |
Official Symbol | SIRT6 |
Synonyms | SIRT6; sirtuin 6; NAD-dependent deacetylase sirtuin-6; sirtuin type 6; SIR2-like protein 6; sir2-related protein type 6; SIR2L6; |
Gene ID | 51548 |
mRNA Refseq | NM_001193285 |
Protein Refseq | NP_001180214 |
MIM | 606211 |
UniProt ID | Q8N6T7 |
Chromosome Location | 19p13.3 |
Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function | NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; NAD-dependent histone deacetylase activity (H3-K9 specific); hydrolase activity; metal ion binding; protein binding; zinc ion binding; |
◆ Recombinant Proteins | ||
SIRT6-2691H | Recombinant Human SIRT6 Protein, His-tagged | +Inquiry |
SIRT6-304Z | Recombinant Zebrafish SIRT6 | +Inquiry |
Sirt6-1381M | Recombinant Mouse Sirt6 protein, His-tagged | +Inquiry |
SIRT6-2684H | Recombinant Human SIRT6, GST-tagged | +Inquiry |
SIRT6-24H | Recombinant Human SIRT6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT6-1829HCL | Recombinant Human SIRT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT6 Products
Required fields are marked with *
My Review for All SIRT6 Products
Required fields are marked with *