Recombinant Human SIVA1 Protein (1-110 aa), His-SUMO-tagged
| Cat.No. : | SIVA1-812H |
| Product Overview : | Recombinant Human SIVA1 Protein (1-110 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-110 aa |
| Description : | Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 27.8 kDa |
| AA Sequence : | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | SIVA1 SIVA1, apoptosis-inducing factor [ Homo sapiens ] |
| Official Symbol | SIVA1 |
| Synonyms | SIVA1; CD27BP; SIVA; Siva 1; Siva 2; Siva-1; Siva-2; |
| Gene ID | 10572 |
| mRNA Refseq | NM_006427 |
| Protein Refseq | NP_006418 |
| MIM | 605567 |
| UniProt ID | O15304 |
| ◆ Recombinant Proteins | ||
| SIVA1-4025R | Recombinant Rhesus Macaque SIVA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SIVA1-277H | Recombinant Human SIVA1, apoptosis-inducing factor, His-tagged | +Inquiry |
| SIVA1-4923C | Recombinant Chicken SIVA1 | +Inquiry |
| SIVA1-1519H | Recombinant Human SIVA1 Protein (1-110 aa), His-tagged | +Inquiry |
| SIVA1-15160M | Recombinant Mouse SIVA1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIVA1-1826HCL | Recombinant Human SIVA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIVA1 Products
Required fields are marked with *
My Review for All SIVA1 Products
Required fields are marked with *
