Recombinant Human SIVA1 Protein (1-110 aa), His-tagged

• Cat.No.: SIVA1-1519H
• Product Overview: Recombinant Human SIVA1 Protein (1-110 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of isoform 2.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-110 aa
• Description: Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.8 kDa
• AA Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: SIVA1 SIVA1, apoptosis-inducing factor [ Homo sapiens ]
• Official Symbol: SIVA1
• Synonyms: SIVA1; CD27BP; SIVA; Siva 1; Siva 2; Siva-1; Siva-2
• Gene ID: 10572
• mRNA Refseq: NM_006427
• Protein Refseq: NP_006418
• MIM: 605567
• UniProt ID: O15304