Recombinant Human SIVA1 protein, GST-tagged
| Cat.No. : | SIVA1-3615H |
| Product Overview : | Recombinant Human SIVA1 protein(1-68 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-68 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SIVA1 SIVA1, apoptosis-inducing factor [ Homo sapiens ] |
| Official Symbol | SIVA1 |
| Synonyms | SIVA1; SIVA1, apoptosis-inducing factor; apoptosis regulatory protein Siva; CD27BP; SIVA; Siva 1; Siva 2; CD27-binding (Siva) protein; Siva-1; Siva-2; |
| Gene ID | 10572 |
| mRNA Refseq | NM_006427 |
| Protein Refseq | NP_006418 |
| MIM | 605567 |
| UniProt ID | O15304 |
| ◆ Recombinant Proteins | ||
| SIVA1-4967H | Recombinant Human SIVA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SIVA1-812H | Recombinant Human SIVA1 Protein (1-110 aa), His-SUMO-tagged | +Inquiry |
| SIVA1-6743H | Recombinant Human SIVA1 protein, His-tagged | +Inquiry |
| SIVA1-3615H | Recombinant Human SIVA1 protein, GST-tagged | +Inquiry |
| SIVA1-8185M | Recombinant Mouse SIVA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIVA1-1826HCL | Recombinant Human SIVA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIVA1 Products
Required fields are marked with *
My Review for All SIVA1 Products
Required fields are marked with *
