Recombinant Human SKA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SKA1-1520H
Product Overview : SKA1 MS Standard C13 and N15-labeled recombinant protein (NP_659497) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SKA1 (Spindle And Kinetochore Associated Complex Subunit 1) is a Protein Coding gene. Diseases associated with SKA1 include Adenoid Cystic Carcinoma and Acute Poststreptococcal Glomerulonephritis. Among its related pathways are Signaling by GPCR and Mitotic Prometaphase. Gene Ontology (GO) annotations related to this gene include microtubule binding.
Molecular Mass : 29.5 kDa
AA Sequence : MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVITTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SKA1 spindle and kinetochore associated complex subunit 1 [ Homo sapiens (human) ]
Official Symbol SKA1
Synonyms SKA1; spindle and kinetochore associated complex subunit 1; C18orf24, chromosome 18 open reading frame 24; spindle and kinetochore-associated protein 1; MGC10200; spindle and KT (kinetochore) associated 1; C18orf24;
Gene ID 220134
mRNA Refseq NM_145060
Protein Refseq NP_659497
MIM 616673
UniProt ID Q96BD8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SKA1 Products

Required fields are marked with *

My Review for All SKA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon