Recombinant Human SKAP1 protein, His-SUMO-tagged
| Cat.No. : | SKAP1-4587H |
| Product Overview : | Recombinant Human SKAP1 protein(Q86WV1)(1-358aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-358aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 57.3 kDa |
| AA Sequence : | MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SKAP1 src kinase associated phosphoprotein 1 [ Homo sapiens ] |
| Official Symbol | SKAP1 |
| Synonyms | SKAP1; src kinase associated phosphoprotein 1; SCAP1, src family associated phosphoprotein 1; src kinase-associated phosphoprotein 1; SKAP55; pp55; SKAP-55; src family associated phosphoprotein 1; src family-associated phosphoprotein 1; src kinase-associated phosphoprotein of 55 kDa; SCAP1; |
| Gene ID | 8631 |
| mRNA Refseq | NM_001075099 |
| Protein Refseq | NP_001068567 |
| MIM | 604969 |
| UniProt ID | Q86WV1 |
| ◆ Recombinant Proteins | ||
| SKAP1-2156H | Recombinant Human SKAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SKAP1-01H | Recombinant Human src kinase associated phosphoprotein 1 protein, His tagged | +Inquiry |
| SKAP1-2687H | Recombinant Human SKAP1, GST-tagged | +Inquiry |
| SKAP1-5471H | Recombinant Human SKAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SKAP1-4961Z | Recombinant Zebrafish SKAP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SKAP1-1817HCL | Recombinant Human SKAP1 293 Cell Lysate | +Inquiry |
| SKAP1-1818HCL | Recombinant Human SKAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKAP1 Products
Required fields are marked with *
My Review for All SKAP1 Products
Required fields are marked with *
