Recombinant Human SKIC8 Protein, His-tagged
| Cat.No. : | SKIC8-137H |
| Product Overview : | Recombinant Human SKIC8 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance. |
| Form : | PBS, pH 7.4. |
| Molecular Mass : | 37.1 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI |
| Endotoxin : | ＜10EU/ug |
| Purity : | ＞95% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.2 mg/ml |
| Gene Name | SKIC8 SKI8 subunit of superkiller complex [ Homo sapiens (human) ] |
| Official Symbol | SKIC8 |
| Synonyms | SKI8; REC14; WDR61 |
| Gene ID | 80349 |
| mRNA Refseq | NM_001303247 |
| Protein Refseq | NP_001290176 |
| MIM | 609540 |
| UniProt ID | Q9GZS3 |
| ◆ Recombinant Proteins | ||
| SKIC8-137H | Recombinant Human SKIC8 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKIC8 Products
Required fields are marked with *
My Review for All SKIC8 Products
Required fields are marked with *
Recently Viewed
