Recombinant Human SKP2 protein, His-SUMO-tagged
Cat.No. : | SKP2-4367H |
Product Overview : | Recombinant Human SKP2 protein(Q13309)(1-424aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-424aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SKP2 S-phase kinase-associated protein 2, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | SKP2 |
Synonyms | SKP2; S-phase kinase-associated protein 2, E3 ubiquitin protein ligase; S phase kinase associated protein 2 (p45); S-phase kinase-associated protein 2; FBL1; FBXL1; p45; p45skp2; F-box/LRR-repeat protein 1; CDK2/cyclin A-associated protein p45; S-phase kinase-associated protein 2 (p45); FLB1; MGC1366; |
Gene ID | 6502 |
mRNA Refseq | NM_001243120 |
Protein Refseq | NP_001230049 |
MIM | 601436 |
UniProt ID | Q13309 |
◆ Recombinant Proteins | ||
SKP2-1465H | Recombinant Human S-Phase Kinase-Associated Protein 2 (p45), GST-tagged | +Inquiry |
SKP2-1819C | Recombinant Chicken SKP2 | +Inquiry |
SKP2-42H | Recombinant Human SKP2 protein, MYC/DDK-tagged | +Inquiry |
SKP2-1144H | Recombinant Human SKP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SKP2-31723TH | Recombinant Human SKP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKP2-1812HCL | Recombinant Human SKP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKP2 Products
Required fields are marked with *
My Review for All SKP2 Products
Required fields are marked with *