Recombinant Human SKP2 protein, His-tagged
| Cat.No. : | SKP2-5764H |
| Product Overview : | Recombinant Human SKP2 protein(1-344 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-344 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SKP2 S-phase kinase-associated protein 2, E3 ubiquitin protein ligase [ Homo sapiens ] |
| Official Symbol | SKP2 |
| Synonyms | SKP2; S-phase kinase-associated protein 2, E3 ubiquitin protein ligase; S phase kinase associated protein 2 (p45); S-phase kinase-associated protein 2; FBL1; FBXL1; p45; p45skp2; F-box/LRR-repeat protein 1; CDK2/cyclin A-associated protein p45; S-phase kinase-associated protein 2 (p45); FLB1; MGC1366; |
| Gene ID | 6502 |
| mRNA Refseq | NM_001243120 |
| Protein Refseq | NP_001230049 |
| MIM | 601436 |
| UniProt ID | Q13309 |
| ◆ Recombinant Proteins | ||
| SKP2-31723TH | Recombinant Human SKP2 | +Inquiry |
| SKP2-6295H | Recombinant Human SKP2 Protein (Lys43-Leu354), N-His tagged | +Inquiry |
| SKP2-5764H | Recombinant Human SKP2 protein, His-tagged | +Inquiry |
| SKP2-1465H | Recombinant Human S-Phase Kinase-Associated Protein 2 (p45), GST-tagged | +Inquiry |
| SKP2-684H | Recombinant Human S-phase Kinase-associated Protein 2 (p45) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SKP2-1812HCL | Recombinant Human SKP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKP2 Products
Required fields are marked with *
My Review for All SKP2 Products
Required fields are marked with *
