Recombinant Human SKP2 protein, His-tagged

• Cat.No.: SKP2-5764H
• Product Overview: Recombinant Human SKP2 protein(1-344 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-344 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SKP2 S-phase kinase-associated protein 2, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: SKP2
• Synonyms: SKP2; S-phase kinase-associated protein 2, E3 ubiquitin protein ligase; S phase kinase associated protein 2 (p45); S-phase kinase-associated protein 2; FBL1; FBXL1; p45; p45skp2; F-box/LRR-repeat protein 1; CDK2/cyclin A-associated protein p45; S-phase kinase-associated protein 2 (p45); FLB1; MGC1366
• Gene ID: 6502
• mRNA Refseq: NM_001243120
• Protein Refseq: NP_001230049
• MIM: 601436
• UniProt ID: Q13309