Recombinant Human SLAMF7 Protein, His-tagged
Cat.No. : | SLAMF7-121H |
Product Overview : | Recombinant Human SLAMF7 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CRACC/SLAMF7/CD319 (also known as CS1) is a member of the signaling lymphocytic activation molecule (SLAM) family. It is a single-pass type l transmembrane glycoprotein expressed on NK cells, subsets of mature dendritic cells, activated B and T lymphocytes, but not in promyelocytic B or T cell lines. Expression of this protein has been detected in the spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung, and trachea. Homophilic interactions of CRACC/SLAMF7/CD319 modulate the activity and differentiation of immune cells. CRACC/SLAMF7/CD319 may function as an inhibitory or activating receptor in immune cells depending on cellular context and availability of adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. In the presence of SH2D1B/EAT-2, CRACC/SLAMF7/CD319 activates NK cells and B cells. T cells lack SH2D1B/EAT-2 expression, and therefore CRACC/SLAMF7/CD319 acts as an inhibitory receptor. In LPS-activated monocytes, CRACC/SLAMF7/CD319 negatively regulates production of proinflammatory cytokines. CRACC/SLAMF7/CD319 is upregulated in multiple myeloma and is implicated in the uncontrolled proliferation of these cells, and thus has become the target for therapeutic intervention. Seven isoforms of CRACC/SLAMF7/CD319 produced by alternative splicing have been identified. |
Molecular Mass : | ~25 kDa |
AA Sequence : | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | SLAMF7 SLAM family member 7 [ Homo sapiens (human) ] |
Official Symbol | SLAMF7 |
Synonyms | SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein; |
Gene ID | 57823 |
mRNA Refseq | NM_021181 |
Protein Refseq | NP_067004 |
MIM | 606625 |
UniProt ID | Q9NQ25 |
◆ Recombinant Proteins | ||
SLAMF7-0692H | Recombinant Human SLAMF7 protein, hFc-tagged | +Inquiry |
SLAMF7-1424H | Recombinant Human SLAMF7 Protein (Ser23-His175), N-His tagged | +Inquiry |
SLAMF7-1727R | Recombinant Rhesus Monkey SLAMF7 Protein, hIgG4-tagged | +Inquiry |
SLAMF7-051H | Active Recombinant Human SLAMF7 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
SLAMF7-5046H | Recombinant Human SLAMF7 Protein (Met1-Met226), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *