Recombinant Human SLAMF7 Protein, His-tagged

Cat.No. : SLAMF7-121H
Product Overview : Recombinant Human SLAMF7 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CRACC/SLAMF7/CD319 (also known as CS1) is a member of the signaling lymphocytic activation molecule (SLAM) family. It is a single-pass type l transmembrane glycoprotein expressed on NK cells, subsets of mature dendritic cells, activated B and T lymphocytes, but not in promyelocytic B or T cell lines. Expression of this protein has been detected in the spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung, and trachea. Homophilic interactions of CRACC/SLAMF7/CD319 modulate the activity and differentiation of immune cells. CRACC/SLAMF7/CD319 may function as an inhibitory or activating receptor in immune cells depending on cellular context and availability of adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. In the presence of SH2D1B/EAT-2, CRACC/SLAMF7/CD319 activates NK cells and B cells. T cells lack SH2D1B/EAT-2 expression, and therefore CRACC/SLAMF7/CD319 acts as an inhibitory receptor. In LPS-activated monocytes, CRACC/SLAMF7/CD319 negatively regulates production of proinflammatory cytokines. CRACC/SLAMF7/CD319 is upregulated in multiple myeloma and is implicated in the uncontrolled proliferation of these cells, and thus has become the target for therapeutic intervention. Seven isoforms of CRACC/SLAMF7/CD319 produced by alternative splicing have been identified.
Molecular Mass : ~25 kDa
AA Sequence : SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name SLAMF7 SLAM family member 7 [ Homo sapiens (human) ]
Official Symbol SLAMF7
Synonyms SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein;
Gene ID 57823
mRNA Refseq NM_021181
Protein Refseq NP_067004
MIM 606625
UniProt ID Q9NQ25

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLAMF7 Products

Required fields are marked with *

My Review for All SLAMF7 Products

Required fields are marked with *

0
cart-icon