Recombinant Human SLAMF8 Protein, His-tagged

Cat.No. : SLAMF8-726H
Product Overview : Recombinant Human SLAMF8(Ala23-Asp233) fused with His tag at the C-terminus was produced in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Ala23-Asp233
Description : SLAM family member 8(SLAMF8) is a single-pass type I membrane protein and contains 1 Ig-like C2-type (immunoglobulin-like) domain. SLAMF8 encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. The protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that it may function during B cell lineage commitment.
Form : Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
AA sequence : AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLS LELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSC WAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPW DSCHHEAAPGKASYKDVDHHHHHH
Endotoxin : Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name SLAMF8 SLAM family member 8 [ Homo sapiens ]
Official Symbol SLAMF8
Synonyms SLAMF8; SLAM family member 8; BLAME; CD353; SBBI42; BCM-like membrane protein; B lymphocyte activator macrophage expressed; B-lymphocyte activator macrophage expressed; FLJ20442; MGC129578;
Gene ID 56833
mRNA Refseq NM_020125
Protein Refseq NP_064510
MIM 606620
UniProt ID Q9P0V8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLAMF8 Products

Required fields are marked with *

My Review for All SLAMF8 Products

Required fields are marked with *

0
cart-icon
0
compare icon