Recombinant Human SLC10A1 Protein
Cat.No. : | SLC10A1-680H |
Product Overview : | Recombinant Human SLC10A1 Full-Length ORF Protein is produced by Wheat Germ (in vitro) expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the bile duct, and the kidney with an apical localization (SLC10A2; MIM 601295), and the other being found in the basolateral membranes of hepatocytes (SLC10A1). |
Form : | Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA |
Applications : | Antibody Production |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC10A1 solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [ Homo sapiens ] |
Official Symbol | SLC10A1 |
Synonyms | SLC10A1; NTCP; |
Gene ID | 6554 |
mRNA Refseq | NM_003049 |
Protein Refseq | NP_003040 |
MIM | 182396 |
UniProt ID | Q14973 |
◆ Recombinant Proteins | ||
RFL25894RF | Recombinant Full Length Rat Sodium/Bile Acid Cotransporter(Slc10A1) Protein, His-Tagged | +Inquiry |
SLC10A1-6826HF | Recombinant Full Length Human SLC10A1 Protein | +Inquiry |
SLC10A1-2693H | Recombinant Human SLC10A1 Protein, His-tagged | +Inquiry |
SLC10A1-413HFL | Recombinant Full Length Human SLC10A1 Protein, C-Flag-tagged | +Inquiry |
SLC10A1-0094H | Recombinant Human SLC10A1 Protein (M1-A349), eGFP, Strep II, 10×His tagged | +Inquiry |
◆ Native Proteins | ||
SLC10A1-5418R | Recombinant Full Length Rat SLC10A1 Protein, Tag Free | +Inquiry |
SLC10A1-921C | Recombinant Cynomolgus Monkey SLC10A1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC10A1-1807HCL | Recombinant Human SLC10A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC10A1 Products
Required fields are marked with *
My Review for All SLC10A1 Products
Required fields are marked with *