Recombinant Human SLC10A7 Protein, GST-tagged

Cat.No. : SLC10A7-4044H
Product Overview : Human DKFZP566M114 full-length ORF ( AAH63471, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SLC10A7 (Solute Carrier Family 10 Member 7) is a Protein Coding gene. GO annotations related to this gene include symporter activity.
Molecular Mass : 43.23 kDa
AA Sequence : MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQLLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SLC10A7 solute carrier family 10 (sodium/bile acid cotransporter family), member 7 [ Homo sapiens ]
Official Symbol SLC10A7
Synonyms SLC10A7; solute carrier family 10 (sodium/bile acid cotransporter family), member 7; C4orf13, chromosome 4 open reading frame 13; sodium/bile acid cotransporter 7; DKFZp313H0531; DKFZp566M114; DKFZp779O2438; MGC25043; SBF-domain containing protein; Na(+)/bile acid cotransporter 7; solute carrier family 10 member 7; P7; C4orf13;
Gene ID 84068
mRNA Refseq NM_001029998
Protein Refseq NP_001025169
MIM 611459
UniProt ID Q0GE19

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC10A7 Products

Required fields are marked with *

My Review for All SLC10A7 Products

Required fields are marked with *

0
cart-icon