Recombinant Human SLC11A1 protein, GST-tagged

Cat.No. : SLC11A1-1264H
Product Overview : Recombinant Human SLC11A1(1 a.a. - 178 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-178 a.a.
Description : This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.6 kDa
AA Sequence : MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLC11A1 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1 [ Homo sapiens ]
Official Symbol SLC11A1
Synonyms SLC11A1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1; LSH, NRAMP, NRAMP1; natural resistance-associated macrophage protein 1; natural resistance associated macrophage protein 1; NRAMP 1; solute carrier family 11 (sodium/phosphate symporters), member 1; LSH; NRAMP; NRAMP1;
Gene ID 6556
mRNA Refseq NM_000578
Protein Refseq NP_000569
MIM 600266
UniProt ID P49279
Chromosome Location 2q35
Pathway Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metal ion SLC transporters, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function manganese ion transmembrane transporter activity; metal ion:hydrogen antiporter activity; molecular_function; protein homodimerization activity; transition metal ion transmembrane transporter activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC11A1 Products

Required fields are marked with *

My Review for All SLC11A1 Products

Required fields are marked with *

0
cart-icon