Recombinant Human SLC18A2
Cat.No. : | SLC18A2-29830TH |
Product Overview : | Recombinant fragment corresponding to amino acids 53-151 of Human VMAT2 with proprietary tag; Predicted MWt 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (summary by Peter et al. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL |
Sequence Similarities : | Belongs to the major facilitator superfamily. Vesicular transporter family. |
Gene Name | SLC18A2 solute carrier family 18 (vesicular monoamine), member 2 [ Homo sapiens ] |
Official Symbol | SLC18A2 |
Synonyms | SLC18A2; solute carrier family 18 (vesicular monoamine), member 2; VMAT2; synaptic vesicular amine transporter; SVAT; SVMT; |
Gene ID | 6571 |
mRNA Refseq | NM_003054 |
Protein Refseq | NP_003045 |
MIM | 193001 |
Uniprot ID | Q05940 |
Chromosome Location | 10q25 |
Pathway | Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Na+/Cl- dependent neurotransmitter transporters, organism-specific biosystem; Neuronal System, organism-specific biosystem; |
Function | drug binding; enzyme binding; heat shock protein binding; monoamine transmembrane transporter activity; serotonin transmembrane transporter activity; |
◆ Recombinant Proteins | ||
SLC18A2-16H | Recombinant Human SLC18A2 Protein, His-tagged | +Inquiry |
SLC18A2-1559HFL | Recombinant Full Length Human SLC18A2 Protein, C-Flag-tagged | +Inquiry |
SLC18A2-29830TH | Recombinant Human SLC18A2 | +Inquiry |
SLC18A2-2023H | Recombinant Human SLC18A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC18A2-5444R | Recombinant Rat SLC18A2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC18A2 Products
Required fields are marked with *
My Review for All SLC18A2 Products
Required fields are marked with *
0
Inquiry Basket